KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677192
Entry
104677192         CDS       T03989                                 

Gene name
IGF1R
Definition
(RefSeq) insulin-like growth factor 1 receptor isoform X1
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04114  Oocyte meiosis
rro04140  Autophagy - animal
rro04144  Endocytosis
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04510  Focal adhesion
rro04520  Adherens junction
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04730  Long-term depression
rro04913  Ovarian steroidogenesis
rro04914  Progesterone-mediated oocyte maturation
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05205  Proteoglycans in cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104677192 (IGF1R)
   04014 Ras signaling pathway
    104677192 (IGF1R)
   04015 Rap1 signaling pathway
    104677192 (IGF1R)
   04066 HIF-1 signaling pathway
    104677192 (IGF1R)
   04068 FoxO signaling pathway
    104677192 (IGF1R)
   04151 PI3K-Akt signaling pathway
    104677192 (IGF1R)
   04152 AMPK signaling pathway
    104677192 (IGF1R)
   04150 mTOR signaling pathway
    104677192 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104677192 (IGF1R)
   04140 Autophagy - animal
    104677192 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    104677192 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104677192 (IGF1R)
   04520 Adherens junction
    104677192 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    104677192 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    104677192 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    104677192 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    104677192 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    104677192 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    104677192 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104677192 (IGF1R)
   05202 Transcriptional misregulation in cancer
    104677192 (IGF1R)
   05205 Proteoglycans in cancer
    104677192 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104677192 (IGF1R)
   05214 Glioma
    104677192 (IGF1R)
   05218 Melanoma
    104677192 (IGF1R)
   05215 Prostate cancer
    104677192 (IGF1R)
   05224 Breast cancer
    104677192 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104677192 (IGF1R)
   01522 Endocrine resistance
    104677192 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104677192 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rro04090]
    104677192 (IGF1R)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104677192 (IGF1R)
Protein kinases [BR:rro01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   104677192 (IGF1R)
CD molecules [BR:rro04090]
 Proteins
  104677192 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD DUF4476
Other DBs
NCBI-GeneID: 104677192
NCBI-ProteinID: XP_010380460
UniProt: A0A2K6PRD9
LinkDB
Position
5
AA seq 1367 aa
MKSGSGEGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSACGKRACTENNECCHPECLGSCS
APDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRH
NYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDLEELETEYPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHR
KRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKG
VVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARN
CMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL
EIISSIKDEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRH
SGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
NT seq 4104 nt   +upstreamnt  +downstreamnt
atgaagtctggctctggagaagggtccccgacctcgctgtgggggctcctgtttctctcc
gccgcgctctcgctctggccgacgagtggagaaatctgtgggccgggcattgacatccgc
aacgactatcagcagctgaagcgcctggagaactgcacggtgatcgagggctaccttcac
atcctgctcatctccaaggccgaggactaccgcagctaccgcttccccaagctcacggtc
atcaccgagtacttgcttttgttccgagtggctggcctagagagcctcggagacctgttc
cccaacctcacggtaatccgcggctggaaactcttctacaactacgccctggtcatcttt
gagatgaccaatctcaaggatattgggctttacaacctgaggaacattactcggggggcc
atcaggattgagaaaaatgctgacctctgttacctctccactgtggactggtccctgatc
ctggatgcagtgtccaataactacattgtggggaataagcccccaaaggaatgtggggac
ctgtgtccaggtaccatggaggagaagccgatgtgcgagaagaccaccatcaacaatgag
tacaactaccgctgctggaccacaaaccgctgccagaaaatgtgcccgagcgcatgtggg
aagagggcatgcaccgagaacaacgagtgctgccaccccgagtgcctgggcagctgcagc
gcgcctgacaacgacacggcctgtgtagcttgccgccactactactacgccggtgtctgc
gtgcctgcctgcccgcccaacacctacaggtttgagggctggcgctgtgtggaccgtgac
ttctgcgccaacatcctcagcgccgagagcagcgactccgagggtttcgtgatccacgac
ggcgagtgcatgcaggagtgcccctcaggcttcatccgcaacggcagccagagcatgtac
tgcatcccttgtgaaggtccttgccccaaggtctgtgaggaagagaagaaaacaaagacc
attgattctgttacttctgctcagatgctccaaggatgcaccatcttcaagggcaatttg
ctcattaacatccgacgggggaataacattgcttcagaactggagaacttcatgggtctc
atcgaggtggtgacgggctacgtgaagatccgccattcccatgccttggtctccttgtcc
ttcctaaaaaaccttcgcctcatcttaggagaggagcagctagaagggaattactccttc
tacgtcctcgacaaccagaacttgcagcaactatgggactgggaccaccgcaatctgacc
atcaaagcagggaaaatgtactttgctttcaatcccaaattgtgtgtttcggaaatttac
cgcatggaggaagtgacggggactaaagggcgccaaagcaaaggggacataaacaccagg
aacaacggggagagagcctcctgtgaaagtgacgtcctgcatttcacctccaccaccacg
tggaagaatcgcatcatcataacctggcaccggtaccggccccctgactacagggatctc
atcagcttcaccgtttactacaaggaagcaccttttaagaatgtcacggagtatgatggg
caggatgcctgcggctccaacagctggaacatggtggacgtggacctcccgcccaacaag
gacgtggagcccggcatcttactgcatgggctgaagccctggactcagtacgccgtttac
gtcaaggctgtgaccctcaccatggtggagaacgaccatatccgtggggccaagagtgag
atcttgtacattcgcaccaatgcttcagttccttccattcccttggacgttctttcagca
tcgaactcctcttctcagttaatcgtgaagtggaaccctccctctctgcccaacggcaac
ctgagttactacattgtgcgctggcagcggcagcctcaggacggctacctttaccggcac
aattactgctccaaagacaaaatccccatcaggaagtatgccgacggcaccatcgacatt
gaggaggtcacagagaacccgaagactgaggtgtgtggtggagagaaagggccttgctgc
gcctgccccaaaactgaagctgagaagcaggctgagaaggaggaggctgagtaccgcaaa
gtctttgagaatttcctgcacaactccatctttgtgcccagacctgaaaggaagcggaga
gatgtcatgcaagtggccaacaccaccatgtccagccgaagcaggaacaccacggcggca
gacacctacaacattacagatctggaagagctagagacagagtaccctttctttgagagc
agagtggataataaggagagaactgtcatttctaaccttcgacctttcacattgtaccgc
attgatatccacagctgcaaccacgaggctgagaaactgggctgcagcgcctccaacttt
gtctttgcaaggactatgcccgcagaaggagcagatgacattcctgggccagtgacctgg
gagccaaggcctgaaaactccatctttttaaagtggccagaacctgagaatcccaatgga
ttgattctaatgtatgaaataaaatacggatcacaagttgaggatcagcgagaatgtgtg
tccagacaggaatacaggaagtatggaggggccaagctaaaccggctaaacccggggaac
tacacagcccggattcaggccacatctctctctgggaatgggtcgtggacagatcctgtg
ttcttctatgtccaggccaaaacaggatatgaaaacttcatccatctgatcatcgctctg
cctgtcgctgtcctgttgatcgtgggagggttggtgattatgctgtacgtcttccataga
aagagaaataacagcaggctggggaatggagtgctgtacgcatctgtgaacccagagtac
ttcagcgctgcagatgtgtatgttcctgatgagtgggaggtggctcgggagaagatcacc
atgagccgggaacttgggcaggggtcgtttgggatggtctatgaaggagttgccaagggt
gtggtgaaagacgaacctgaaaccagagtggccattaaaacagtgaacgaggccgcgagc
atgcgtgaaaggattgagtttctcaacgaggcttctgtgatgaaggagttcaattgtcac
catgtggtgcggttgctgggtgtggtgtcccagggccagccaacgctggtcatcatggaa
ctgatgacacggggcgatctcaaaagttatctccggtctctgaggccagaaatggagaat
aatccagtcctagcacctccaagcctaagcaagatgattcagatggctggagagattgca
gacggcatggcatacctgaacgccaacaagttcgtccacagagaccttgctgcccggaat
tgcatggtagccgaggatttcacagtcaaaattggagattttgggatgacgcgagatatc
tatgaaacagactattaccggaaaggagggaaagggctgttgcccgtgcgctggatgtct
cccgagtccctcaaggatggagtcttcaccacttactcagacgtctggtccttcggggtt
gtcctctgggagatcgccacactggccgagcagccctaccagggcttgtccaacgagcaa
gtccttcgcttcgtcatggagggtggccttctggacaagccagacaactgccccgacatg
ctgtttgaattgatgcgcatgtgctggcagtacaaccccaagatgaggccttccttcctg
gagatcatcagcagcatcaaagacgagatggagcctggcttccgggaggtctccttctac
tacagcgaggagaacaagctgcccgagccagaggagctggacctggagccagagaacatg
gagagcgtccccctggacccctcggcctcctcgtcctccctgccactgcccgacagacac
tcaggacacaaggctgagaacggccccggccctggagtgctggtcctccgcgccagcttt
gatgagagacagccttacgcacacatgaacggtggccgcaagaacgagcgggccttgccg
ctgccccagtcttcgacctgctga

DBGET integrated database retrieval system