KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677536
Entry
104677536         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104677536
   05414 Dilated cardiomyopathy
    104677536
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104677536
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   104677536
Membrane trafficking [BR:rro04131]
 Others
  Actin-binding proteins
   Others
    104677536
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     104677536
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104677536
SSDB
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 V-set Pur_ac_phosph_N fn3_2 C2-set_2 Ig_6 Receptor_2B4 Titin_Z Pkinase C1-set PPAK Tissue_fac PK_Tyr_Ser-Thr DUF2369 Adeno_E3_CR1 THB Ig_4
Other DBs
NCBI-GeneID: 104677536
NCBI-ProteinID: XP_030772217
LinkDB
Position
14
AA seq 34954 aa
MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWIRDGQVISTSTLPGVQISFSD
GRAKLTIPAVTKANSGRYSLRATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQ
VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGELYSLLIAEAYPEDSGTYSVNATN
SVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKIEAHFDARSIATVEMV
TDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPT
PSPVRSVSPAARISTSPIRSVRSPLLMRKTQASTMATGPEVPPPWKQEGYVASSSEAEMR
ETTLTASTQIRTEERWEGRYGVQEQMTISGAAGAVATGAKEVKQDADKSAAVATVVAAVD
MARVREPVISAVEQTAQRTTTTAVHVQPAQEQIRKEAEKTAVTKVVVAADKTKEQELKSR
TREVITTKQEQMHVTHEQIRKETEKTFVPKVVISAAKAKEQETRISGEITTKQKQVTQET
IRQETQITAASMVVVATAKSTKLETVPGAQEETATQQDQMHLSHEKIMKETRKTVVPKVI
VATPKVKEQDLVSRSREGITTKREQVQITQEKMRKEAEKTALSTIAVATAKAKEQETILR
TRETMATRQEQTQVTHGKVDVGKRAEAVATVVAAVDQARVREPREPREPGRLEESYAQQT
TLEYGYKERISAAKVAAEPPQRPASEPHVVPKAVKPVVIQAPSETHIKTTDQMGMHISSQ
IKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHVYEASIAGSAIATLQKELSATS
SAQKITKSVKAPTVKPSETRVRAEPTPSPQFPFADMPDTYKSQAGVEVKKEVGVSITGAT
VREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYP
SPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYL
AVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSITEEQAGPGEPAAPYFITKPAV
QKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADD
AGEYTIVIRNKHGETSASASLLEEADYESLMKSQQEMLYQTQVTAFVQEPKVGETAPGFV
YSEYEKEYEKEQALIRKKMAKDTVMVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEEL
LEEDGEEKMAVDISESEAVESGFELRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKR
IKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAP
TYIPTPEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQ
LERLYKPVFVLKPASFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKED
GTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNVKEG
SRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTA
TAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWE
EGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANR
LRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGR
KGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLFPEPVRVLEGETARFRCRVTGYPQP
KVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQ
QREDFRSVLRRAPEPRPEFHIHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKV
PEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEK
KALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECE
WYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQA
KQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHF
LSILTIDMSDAEDYSCVLVEDENIKTTAKLIVEGAVVEFVKELEDIEVPESYSGELECIV
SPENIEGKWYHNNVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLK
MKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSH
MLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSV
PDVTSVKWYLNDEQIKPDDRVHAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSV
EKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLT
VLNMMKDDEGKYAFYAGENMTSGKLTVAGGAISKPLTDQTVAESQEAVFECEVANPDSKG
EWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVEAVKIK
KTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTVYSLRIKNCA
IVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHK
NVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHITKTMKN
IEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAE
YTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKS
TDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVL
EKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVV
AGGNVSTANLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQV
QERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTV
QSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYT
CEAKNDYGVATTSASLSVEVPEIVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSG
TDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTAN
LSLEAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSSELHLSNINETLELLSEPPVY
STKFDSKKEGAVPVFIKEVSSADTSMGDVATLSVTVIGIPKPKIQWFFNGAPLTPSADYK
FVFDGDDHSLIILFTTLEDEGEYTCMASNDYGQAICSAYLKVNSKGEGHKDTETESAVAK
SLEKLGGPCPPHFLKELKPVRCAQGLPAIFEYTVVGEPAPTVAWFKENKQLCTSVYYTII
HNPDGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLLEDTDMTDTPCKAKSTPE
APEDFPQTPLKGPTVEALDSEQEIATFVKDTILKAALITEENQQLSYEHIAKANELSSQL
PLGAQELQSILKQDKSTPESTREFLCINGSTHFQPLKEPSPNLQLQIVQSQKTFSKESIL
MLEEPETQAVLSETDKIFPSAMFIEQINSLTVEPLKTLLTEPEGNYPQSSIEPPVHSYLT
SVSEEVLLPKEKTVSDANKDQRVTVQKQGAQSALILSQSLAEGHVESLQSPDVMISQVNY
EPLVPSEHSCTEGAEILIESTDPLENAGQDSAVRIEEGKSLRFPLALEEKQVLLKEEHSD
NMVMPPDQIIESKREPVAIKKVQEVQGRDILSKESLLSGIPEEQRLNLKIQICRALQAAV
ASEQPGLFSEWLRNIEKVEVTAVNITQEPRHIMCTYLVTSAKSVTEEVTIIIEDVDPQIT
NLKMELKDVLCAIIYEEISILTAEGPRIQQGAKTSLQEEMDSFSGSQKVEPITEPEVESK
YLISSEEVSYFNVQSQVKYLDATTVTNGVASAVVSDEKQDESLKPSEEKEESSSESGTEE
VGTVKIQEAEGGLIKEDGPVIHTPLMDTVSEEGDIVHLTTSITNAKEVNWYFENKLVPSD
EKFKCLQDQNTYTLVIDKVNTEDHQGEYVCEALNDNGKTATSAKLTVVKRAAPVIRRRIE
PLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYVSSLEILRTQVVDC
GEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSLTTFVGKSAKFLCTVTGTPVIETI
WQKDGAALSPSPNRKISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELVIIDK
PHFIKELESVQSAINKKVRLECQVDEDRKVTVTWNKDGQKLPPGKDYKICFEDKIATLEI
PLAKLRDSGTYVCIASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKLKG
SPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCST
EIVIKEPPSFIKTLEPADIVRGTNALLQCEISGTGPFEISWFKDKKQIRSSKKYRLFSQK
SLVCLEIFSFNSADVGDYECVVANEVGKCGCRATHLLKEPPTFVKKVDDFIALAGQTVTL
QAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAG
SQTSVGELIVKEPAKIIERAELIQVTAGDPATLEYTVTGTPELKPKWYKDGRPLVASKKY
RISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVD
SVVNGTCRLDCKIAGSLPMRVSWFKDGKEITSSDRYRIAFVEGTASLEIIRVDMNDAGNF
TCRATNSVGSKDSSGALIVQEPPSFVIKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGN
KELVSGGSCYITKEALESSLELYAVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVE
KLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESAAVLKLTDVG
IEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFE
ITWFKDNTTLRSGRKFKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLR
EPPSFIKKIESTSSLRGGTAAFQATLKGSLPIMVTWLKDNDEITEDDNIRMTFENNVASL
YLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSIDVTHGDPATLQVKFS
GTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCK
ARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKF
SFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPNT
RVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTILELFAAKATDSGTYICQLS
NDVGTATSKVTLFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPEIRVSWYLDGNEIT
AIQKHGISFIDGLATFQISSARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKP
VEVVKDSDMELECEVTGTPPFEVIWLRNNKEIRSSKKYTLTDRVSIFNLHITKCDPSDTG
EYQCIVSNEGGSCSCSARVALKEPPSFIKKIENTTTVLKTSATFQSIVAGSPPISITWLK
DDQILDEDDNIYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQI
IEKAKSVDVTEKDPVTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSV
MTQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGS
LPISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGI
LTVKEPPSFLVKPGRQQAIPDSTVEFKAVLKGTPPFKIKWFKDDVELVSGPKCFIGLEGS
TSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRL
ECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVLQMNNLSTEDSGDFICEAQNPAG
STSCSTKVIVKEPPVFSSFPPVVETLKNAEVSLECELSGTPPFEVVWYKDKRQLRSSKKY
KIASKNFHTSIHILNVDTSDIGEYHCKAHNEVGSDTCVCTVKLKEPPRFVSKLNSLAVVA
GEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYIC
QIKNDGGMRENMATLTVLEPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKL
LTSSQKHKFSFYNKISSLKILSVERQDAGIYTFQVQNNVGKSSCTAVVDVSDRTVPPSFT
RRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTAFSDNVCTLQLNSLD
SSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFK
VGWFRGARELVKGDQCNIYFEDTVAELELFNIDISQSGEYTCVVSNDAGQASCTTRLFVK
EPAAFVKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCIL
EILNSTKRDAGRYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEASVGDLVSLQCQVA
GTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNLNDSGEYTCKAENSIGTASSK
TVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQT
SFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVI
AGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTC
QATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDS
ELHESWKYNMSFIHSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPIFTQK
PSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHILNLEAS
DIGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLIGDTVELRAIVEGFQPISVV
WLKDKGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLE
PARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLK
IPSAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASIVLECR
VSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDE
CSAVLTVQEPPSFEQTPDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNIS
LEDFVTELELFEVQPLQSGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSVETGSP
IVLEATYTGTPPISVSWIKDEYLLSQSERCSITMTEKSTILEILESTIEDYAQYSCLIEN
EAGQDICEALVAVLEPPYFTEPLEHVEAAIGEPATLQCKVDGTPEIRISWYKEHTKLRSA
PAYKMQFKNNIASLVINKVDHSDVGEYSCKAENSVGAVASSAVLVIKERKLPPSFARKLK
DVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHV
GQYNCSASNPLGTASSSARLILSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGTAPIKI
TWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNVAGKDSCSAQLGVQE
PPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKNETEIQESSKFRMSFVDSVAVL
EMHNLGVDDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPVETLKGADVHLECELQ
GTPPFHVSWHKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCV
GSITLKAPPSFVKKLSDITTVVGKEVQLQTIIEGAEPISVVWFKDKGEVVRESDNTWISY
SENIATLQFSRVEPASAGKYTCQIKNDAGMQECFAMLSILEPATIVEKPESIKVTTGDTC
TLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVSCLKIIKVAPSDSGVYSFEVQNP
VGKDSCTASVQVSDRTTPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEIS
SGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPDP
MDVLTGTNVTFTSIVKGTPPFNVSWFKGSSEVVPGDRCNVSLEDSVAELELFDVDTSQSG
EYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKALILEGTFTGTPPILVVWKK
NGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYF
VKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQV
DINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETLGLPVVFDCAISGS
EPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSAR
LILTEGKNPPFFDIPLAPVDAVVGESADFECHVMGTQPIKVSWAKDNREIRSGGNYQISY
LENSARLTVLKVDKGDSGRYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKKLSETVEETE
GNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCK
VSNDAGSALCTSSIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAG
REIKPSDRCSFSFASGTAVLELRDVTKADSGDYVCKASNVAGSDTTKSKVTIKDKPAVAP
AAKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFI
HQKGDEAKLEIRDTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKKQEKIEGDLRAMLKK
TPILKKAGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRL
EIEEIERSEKDEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDAVFEIDIKINYP
EIKLSWYKGTQKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLVCGPHIASAKLTVIE
PAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRHKTEVEHKVHKLTIA
DVRAEDQGQYTCKYEDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIV
TWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELYLT
TKEIKLELKPPDIPDSRVPIPTMPIRAVPPEEIPPVVAPPIPLLLPTPEEKKPPAKRIEV
TKKAVKKDAKKVVAKPKEEVTPREELVKKPPPPTTLIPAKAPEIIDVSSKAEEVKIMTIT
RKQEVQKEKEAVYEKKQAVHKERRVFIESFEEPYDELEVEPYTEPFEQPYYEEPDEDYEE
TKVEAKKEVHEEWEEDFEEGQEYYEREEGYDEGEEEWEEAYQEREVIQVQKEVYEESHER
KVPAKVPEKKAPPPPKVIKKPVIEKIEKTSRRMEEEKVQVTKVPEVSKKIVPQKPSRTPV
QEEVIEVKVPAVHTKKMVISEEKMFFASHTEEEVSVTVPEVQKETVTEEKIHVAVSKRVE
PPPKVPELPKKPVPEEAVPVPIPKKVEPPAPKVPEVPKKPVPEEKKPVPVPKKEPAAPPK
VPEVPKKPVPEEKIPVPVAKKKEAPPAKVPEVQKRVVTEEKITIVTQREESPPPAVPEIP
KKKVPEERKPVPRKEEEVPPPKVPALPKKPVPEEKVAAPVPVAKKAPPRGAEVSKKIVVE
EKRFVAEEKLSFAVPQRVEVTRHEVSAEEEWSYSEEEEGVSISVYREEEREEEEEAEVTE
YEVMEEPEEYVVEEKLHIISKRVEAEPAEVTERQEKKIVLKPKIPAKIEEPPPAKVPEAP
KKIVPEKKVPAPVPKKEKVPPPKVPEEPKKPVPEKKVPPKVIKMEEPPPAKVPEEPKRAV
PEEKVPKLKPKREEEPPAKVTEFRKRVVKEEVSIEAPKREPQPTKEVIIMEEKERSYTRE
EAVSVQREEEYEEYEEYDYKEFEEYEPTEEYDQYEEYEEQEYERYEEHEEYITEPEKPIP
VKPVPEEPVPTKPKAPPAKVPKKAVPEEKVPVPIPKKLKPPPPKVPEEPKKVVEEKIRIS
ITKREKEQVTEPAAKVPTKPKRVVAEEKVPVPRKEVAPPVRVPEMPKELEPEEVAFEEEV
VTHVEEYFVEEEEEYIHEEEEFVTEEEVVPVIPVKVPELPKKPVPEEKKPVPVPKKKEAP
PAKVPEVPKKPEEKLPVLIPKKEKAPPAKVPEVPKKPVPEEKVPVPAPKKVEAPPAKVPE
VPKKPVPEKKVPVPVPKKVEAPPAKVPEVPKKLIPEEKKPTPVPKKVEAPPPKVPKKREP
VPVALPQEEEVPFEEEIVPEEEVLPEEEEVLPEEEEIPPEEEEVPPEEEYVPEEEEFVPE
EEVLPEVKPKVPVPAAVPEVPKKPVPEKKVPVPAPKKVEPPPPPKVPEIKKKVTEKKVVI
PKKEEAPPAKVPVVPKKPEPEKKVPPPGLKKAVVPPAKVPEVPKKVEEKRIILPKEEEVL
PVEVTEEPEEEPIPEEEIPEEPPSIEEVEEVAPPRVPEVIKKAVPEAPTPVPKKVEAPPA
KVPKKIPEEKVPVPVQKKEAPPAKVPEVPKKVPEKKVPEKKVLVHKKEAVPPAKGRTVLE
EKVSVAFHQEEVVKERLELEVVEAEVEEIPEEEEFHEVEEYFEEDEFHEVEEFVKVEEHR
VEEEHRVEEVHRVIEVFEAEEVEEYEKPKAPPKGPEISEKIIPPKKPPTKVVPRKEPPAK
VPEVPKKIVVEEKVRAPEEPKVPPTKAPEVPKKIVPEEKVREAVPKKPEVPPAKVPGMPK
KSVQEEKSPIVISEDTEMYIYEASEEADLEEKVLVTQPQKTKPKLAKVPEPPKKVVPEDK
IYVTIPKKRETPATKELDTTKGVFPEVEVPEAIPEIPEHPPTEEFEVFKEVIPEEETPTV
KRRKTPSPTAPEAMKEVVPEMKMFEDVPQEPETPLMKMPEVPQEITPAKRVPSKKREPPS
VKVPEALQEIVPEKKTLVVPLRKPEVLPDEVPEALKEVVTEKKVHPPQRAEVVPVKVHEA
PKEIIPEKKVLVVPPKKPEVPPVKVPEASKEVIPEEKVPLAPLEEPEVPPVKVPKAPKEV
VPEKKVPVAPPKKPEVPPVKVPEAPKEVVPEKKVLMAPPKKPEVPPTKVPEVPKAAVPEK
KVPEAIPPKPESPPPEVPEVLPPKEVVPEKKVPLPPPKKPEAPPPKVPEAPKEVVLEKKV
SVAVPKKPEAPRAKVPEAAQEAVPEKKIPKAPIKKPEAPPVTVPEVPQEAAEKEIPVAPP
KKPEVTTVPVPEAQEVVPEKKVPKAPPKKPEAPPATVPEVPQEIAPEKKTLVPPKRPEVP
PVTVPEAPKEVVPEKKVPLVPPKKPEVPPVKEPEAPKEVVAEKKVPVTPPKKPEVPPVKV
PEAPKEVVPEKKVPLAPPKKPEVPPVKVPEAPKEVVPEKKVPLAPPKKPEVPPVKVPEAP
KEVVPEKKVPVTPPKKPEVPPVKVPEAPKEVIPEKKVPVAPPKKPEVPPTKVPEVPKAAV
PERKVPEAIPPKPESPPPEAFEEPEEVAPEEPPAEVVEEPEPAAPPQVTVPPKKPVPEKK
ARAIVAKKPEPPPVKVPEVPKEVVPEKKVPPVVPKKPEAPPAKVPEVPKEVVPEKKVAVP
KKPEVPPAKVPEVPKKPVLEEKPAVPVPERVESPPPEVYEEPEEIAPEEEEPVPVAEEEE
PKAPPPAVPEEPKKIIPEKKVPVIKKPEAPPPKEPEPEKKVIEKPKLKPRPPAPPPAPPK
EDVREKIFQLKAVPKKKVPEKPEVPEKVELTPLKVPGGEKKVRKLLPERKPEPKEEVVLK
SVLRKRPEEEEPKVEPKKLEKVKKPAVPEPPPPKPAEEVEVPTVTKRERKIPEPTKVPEI
KPPIPLPGPEPKPKPEAEVKTIKPPPVEPEPTPIAAPVTVPVVGKKAEAKAPKEEAAKPK
GPIKGVAKKTPSPIEAERRKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEITDIVLTESE
FVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTC
VLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDVVWRKDGKI
VVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVK
PIRDQHVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAM
PEDIDEYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWK
LKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAV
PLKDVTVPERRQARFECVLTREANVIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFDD
EGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKND
VKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKDLSSTAQLKVLEADPYFTVKLH
DKTAVEKDEIILKCEVSKDVPVKWFKDGEEIVPSPKYSIKADGLRRVLKIKKAELKDKGE
YVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETARFEIELSEPDVHGQWKLKGEPL
TASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVK
VFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYM
FEAEDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHT
TRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGV
EKDEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCD
CGTDKTSGKLDIEDREIKLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTP
DCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAG
ETATFDCELSYEDIPVEWYLKGKKLEPSDKVVTRSEGKVHTLTLRDVKLEDAGEVQLTAK
DFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKY
EIVADGRVRKLIIHGCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEM
ARFECELSRENAKVQWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTA
RTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEI
LTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAE
FVCSISKESFPVQWKRDDKILESGDKYDVIADGKKRVLAVKDATLQDMGTYVVMVGAARA
AAHLTVIEKLRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQK
DLVYTLRIRDARLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIIEPLKDIETMEKKS
VTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRIDKYKHSLTIKDCGFPDEGEYIVTAGQD
KSVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKF
EKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVV
FLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIARDKEA
RAKLELAAAPKIKTGDQDLVVDVGQSLTMVVPYDAYPKAEAEWFKENEPLSTKTIDTTAE
KTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAW
EEPLTDGGSKIIGYVVERRDIKRKTWVLATDRADSCEFTVTGLQKGGVEYLFRVSARNRV
GTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELR
DKTSIRWDTAMTVRAENLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIE
RPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPVLGYIIERCEEGKDNWIRCNKKLVPELT
YKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPN
PIKILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLE
NRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVS
RKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSAPATVPDP
PENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGEPVAETKMEVTG
LEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIEL
PATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCG
RATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVW
HKLSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQASPITAKYQFDPPGPPTRLE
PSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNK
KKYRFRVLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSLRLNWTKPEHD
GGAKIESYIIEMLKTGTDEWVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSE
PSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGW
QTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYAL
AVVDVTKRHVDLKWEPPKNDGGRPIQRYIIEKKERLGTRWVKAGKTAGPDCNFRVTDVIE
GTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEK
NGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSE
PSEISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKAS
DRLTMKNDHISAHLEVPKSVHADAGVYTITLENKLGSATASINVKVIGLPGPCKDIKASD
ITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYF
FRVKAVNKIGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSK
IMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATP
PTKAVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYPTITWIKDENAIVPEEIKKRAA
PLLRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIA
KAPCTVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEW
IVVTSTLRQCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDPFEPPDAPDKPI
VEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGL
TYVFRVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIPRVTDTSSTTIELEWEPPAFNGG
GEIIGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNVAGEGPPGET
EPVTVAEPQEPPTVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRV
VIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNR
KMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETERSKCDITGLLEGQEYKFRVI
AKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYI
IEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQD
DEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTEALQITK
EEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIK
AESCYLTWDAPLDNGGSEITHYVIDKRDASRKKTEWEEVTNTAVEKRYGIWKLIPNGQYE
FRVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPI
TGYWLEKREEGSPYWSRVSRAPVTKVGLKGVEFNVPRLIEGVKYQFRAMAINAAGIGPPS
EPSDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTD
WKRVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEV
FIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDSQLETA
ENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRL
SWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTSFVVPDLLSEQQYFFRVRAENR
FGIGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVEC
LAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGQYEFRVKAVNAAGVSKPSATVGPVT
VKDQTCPPSIELTEFMEVEEGTDVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHV
NKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVS
AEQMTLSWLPPKDDGGSKITNYVIEKREANRKTWVRVSSEPKECTYTIPKLLEGHEYVFR
IMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTG
YWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPS
DPVTARDPIAPPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWERG
KDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVLPDLQLDASV
RDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERALPQEATIETTAISSSMVIKNCQRSHQ
GVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITN
YVIEKRESDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVI
REPITVPERPEDLEVKEVTKSTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDN
LLSRKYTVKDLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTI
RVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPTTLALEKIKAKRSDSGKYC
VVVENSTGSRKGFCQVNVVDRPGPPVGPVIFDEVTKDYMVISWKPPLDDGGSEITNYIIE
KKELGKDVWMPVTSASAKTTCKVSKLLEGKDYIFRIHAENLYGISDPLVSDSMKAKDRFR
VPDAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKRETMSKRWARVTKDPIHPYTK
FRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVD
LTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVL
AVNEAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKV
TWKKEDRDAPTKARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKP
GPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSSLSATSKKKSHLA
KHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGPPKNLHHVDVDKTEVSLVW
NKPDRDGGSPITGYLVEYQEEGTQDWIKFKTVTNLDCVVTGLQQGKTYRFRVKAENIVGL
GLPDTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSE
IKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGP
IHILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQK
GCEYVFRVKAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSD
GGSPITGYYVERREVTGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSNPSP
SSDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQW
NRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVEL
DVTCRDVITVRVGQTIRILARVKGRPAPDITWTKEGKVLVREKRVDIIQDLPRVELQIKE
AVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGG
SEITNFIVEYRKPNQKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVGPTIETKT
PILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERV
HKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGV
LTVKAGDTIRLEAGVRGKPFPEVSWTKDKDATDFTRSPRVKIDTSADSSKFSLTKAKRSD
GGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKIADVSSDRCTVRWDPPEDDGGCEIQN
YILEKCETKRMVWSTYSATVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAK
TKYNKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAI
PERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTK
HSITLAWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDEN
QEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVTVRAGCPIRLFAIV
RGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVF
VNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTP
EVKKTSFQVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPLSEPDPPRKLEVTEM
TKNSATLAWLPPLRDGGAKIDGYIISYREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYK
FRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTC
KWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMD
APGPPQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTS
CRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMVAEFPFGVPSEPKNARVTKVNKDCIFV
AWDRPDSDGGSPITGYLIERKERNSLLWVKANDAPVRSTEYPCAGLVEGLEYSFRIYALN
KAGSSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACK
LPGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAEN
VPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNL
CTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWE
PPLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGV
GDPVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQ
AVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPG
PPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFE
VTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVT
MRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLEN
SCGKKEYTIVVKVLDTPGPPVNVTVKEIAKDSAYVTWEPPIIDGGSPIINYVVQKRDAER
KSWSTVTTECSKTSFRVSNLEEGKSYFFRVFAENEYGIGDPGETRDAVKASQTPGPVVDL
KVRSVTKSSCSIGWKKPHSDGGSRIIGYVVDFLTEENKWQRVMKSLSLQYSAKDLTEGKE
YTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKP
APSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISI
KVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAV
QKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIVEVRHD
SVSLTWTDPRKTGGSPITGYHLEFKERNSLLWKRANKTPLRMRDFKVTGLTEGLEYEFRV
MAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINVTRNSVTLIWTEPKYDGGHKLTGYIV
EKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTGTIICK
DEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITS
TPTSSMLTIKYATRKDAGEYTITATNSFGTKEEHVKVTVLDVPGPPGPIEISNVSAEKAT
LTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKLIQGNEYVFRVSAVN
HYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVER
REKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASNSVLMKDAA
YPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRI
TQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRA
GLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESFTLLIIPECNRYDTGKFVMTIE
NLAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREAT
RKSYSTVTTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPAETTEPVKASEAPSPPDS
LNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITTVKGLECVVRNLTEG
EEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIARAGDNIKVEIPVL
GRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGEVGDV
ITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELA
TTVIRTTYKATRLTTGLEYQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTPQVTAV
TKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYE
FRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPIPLNITRNTVTLKWAKPEYTGGFKITS
YIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAI
TCRDDIEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWTKDGKELEGTAKLEI
KIADFSTHLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSE
KCVLSWLPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVM
AVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTAITKDSMVVCWGHPDSDGGSEIINYI
VERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKAC
DTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAG
LKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVV
TIRACCTLRLFVPIKGRPAPEVKWAREHGESLDKASIESTSSYTLLIVGNVNRFDSGKYI
LTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEK
RESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPL
PPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSKGSDKWATCATVKVTEATITG
LIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVP
FIGRPTPAVIWHKDDVPLRQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAT
ETLNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQI
VSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPIVAQYPFKVPGPPGTPLVT
LSSRDSMEVQWNEPVSDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVE
YEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKI
TGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTG
AITARDEVDPPRISMDPKYKDTIVVHAGESFKIDADIYGKPIPTIQWIKGDQELSNTARL
EIKSTDFATNLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGVT
AEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEYTFR
IMAVNKYGVGEPLESEPVIAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILG
YVLEKRDKEGIRWTRCHKRLIGELRLRVTGLLENHNYEFRVSAENAAGLSEPSPPSAYQK
ACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPP
TGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRK
IINIRAGGSLRLFVPIKGRPTPEVKWGKMDGEIRDAAIIDVTSSFTSLVLDNVNRYDSGK
YTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIV
EKREATRKSYAAVVTNCHKNSWKINELQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEV
PQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLEAVI
SNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIE
VPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGIMVANIVGQ
KTASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVW
DVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPF
ATAISKDSMVIQWHEPVNNGGSPVIGYHLEKKERNSILWTKVNKTIIHDTQFKAQNLEEG
IEYEFRVYAENIVGVGKASKNSECYVARDPCEPPGTPEPIMVKRNEITLQWTKPVYDGGS
MITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDS
TGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESA
RCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTG
VTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYI
FRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEI
IGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVY
YKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVT
PQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSEL
RKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTDKVQIEKGVNYTQLSIDNCDRNDA
GKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSVLLVWEPPIIDGGAKVKNY
VIDKRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAA
EPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRILGYVVEMQPKGTEKWSIVAESKVCNA
VVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEGLK
IEIPVIGRPRPNVSWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTITATNSA
GTATENLSVIVLEKPGPPIGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTT
TWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKPIIVQYPFKEPGPPGT
PFVTSISKDQMLVQWHEPVHDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLD
EGLEYEFKVSAENIVGIGKPSKVSECFIARDPCDPPGRPEAIVITRNNVTLKWKKPAYDG
GSKITGYLVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPS
ESSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEE
TAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLK
VTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTKLLPGN
EYIFRVMAVNKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGG
AEIEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEP
SVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAVDEWT
TCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELD
ADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTMLVIDNVTR
FDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTVREVKKDSVMLSWEPPLIDGGAKI
TNYIVEKRETTRKAYATVTNNCTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPV
KVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKIIGYVVEMQTKGSEKWSTCTQVKT
LEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKARE
QLKIDVPFKGRPQATVNWKKDGQTLKETTRVNVSSSKTVTSLSIKEASREDVGTYELCVS
NSAGSITVPLTIIVLDRPGPPGPIRIDEVSCDNITISWNPPEYDGGCQISNYIVEKRETT
STTWHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPP
GTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSG
LDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHY
DGGAKITGYIVERRELPDGRWLKCNYTNIQETHFEVTELTEDQRYEFRVFAKNAADSVSE
PSESTGPITVKDDVEAPRIMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGVEI
EERARTEIISTDNHTLLTVKDCVRRDTGQYVLTLKNVAGTRSVAINCKVLDKPGPPAGPL
EINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELRTTSCKVTKLLKG
NEYIFRVTGVNKYGVGEPLESVAVKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDG
GSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSE
TSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWLKPLFDGGAPITGYTVEYKKSDDTDW
KTAIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPVFDIDS
EMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYIDTTDSRTSLTIENANRN
DSGKYTLTIQNVLSAASLTLVVKVLDSPGPPTNIAVQDVTKESAVLSWDVPENDGGAPVK
NYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGMPAETKEGVK
ITEKPSPPEKLGVTSTSKDSVSLTWLKPEHDGGSRIVHYVIEALEKGQKNWVKCAVAKST
HHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYVRA
GSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEIT
AANSSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYVLLKR
ETSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTP
GPPSTPWVTNVTRESITVGWHEPVSNGGSAVIGYHLEMKDRNSILWQKANKLVIRTTHFK
VTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQ
PAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFTISGLTQNSQYEFRVFARNAVGS
ISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVRLRAGISGKPAPTIEWYKDD
KELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPG
GPIEFKTVTAEKITILWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECIITTTKI
IKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPI
ADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVSAVNAAGQGP
FSEPSEFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEMRQGEE
EEWTIVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMTEPVQAKDILEAPE
IDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLT
IPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPL
IDGGSPIINYVIEKRDATKRTWSVVSHKCSSTSFKLTELSEKTPFFFRVLAENEIGIGEP
CETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKSEQTWS
HAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPG
AQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEH
GGKYTVILDNAVCRNAVPITVITLGPPSKPKGPIRFDEIKADSVILSWDVPEDDGGGEIT
CYSIEKRETSQTNWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSNIIVA
KHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHIEKKERNSILWQKVNTSP
ISGREYRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRET
ITLKWNPPLRDGGSKIVAYSIEKRQGNERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIA
RNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRV
TWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGIYTVEAKNASGSAKAEIKVKVQD
TPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQS
YTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTVPDAPGTPEPSNVTGNSITL
TWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAE
NAAGVGPASGISRLIKCREPVNPPGPPAVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYII
EMCKADLGDWHKVNTEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVD
RLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTTDSF
STLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWD
APLLDGGARIHHYVVEKREASRRSWQVISEKCTRQILKVGDLAEGVPYYFRVSAVNEYGV
GEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPEHDGGSRITGYLLEMRQKGSD
FWVEAGHTKQLTFTVERLVENTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLT
GITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKES
MRGDSGRYFLTLENTAGVKTFTVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDDGG
TEITNYIVEKRESGTTAWHLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESA
PIVAEHPFVPPSAPTRPEVYYVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKE
NKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDV
TRSTVSLIWSAPVYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGD
TYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLQGDLVTIRAGSDLVLDAA
VGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDTGKYTLTVKNASGTKA
VSVMVKVLDSPGPCGKLTVSRVTEEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIV
EGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGIPEEVG
TGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVMSLMEGCD
YQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYDGG
ADITGYVLEMQEKDTDQWYRVHTKATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSE
SIAEIEPVERIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASR
AIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVS
RDSVTITWEIPTIDGGAPVNNYIIEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFR
VLPENIYGIGEPCETSDAVLVSEVPLVPTKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYV
LEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRVRAQNEKGVSEAREIVTAVTVQ
DLRVLPTIDLSTMPQKTIHVPAGRPIELVIPIAGRPPPAASWFFAGSKLRESERVTVETH
TKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIRIDEIDATSIT
ISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATN
RFGIGSYLQSEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVER
KEVRADRWVRVNKVPVTMTRYRSTGLIEGLEYEHRVTAINARGSGKPSRPSKPIVAMDPI
APPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIR
EYTLTHLPQGAEYRFRILACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQ
GGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTELVIKEADRGDSGTYDLVLE
NKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQARSVRVSWRPPADDGGADILGYILERREV
PKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVIPKTPLNPPE
PPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYT
VTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSVSKDSVTLQ
WEKPECDGGKEILGYWVEYRQSGDSAWKKSSKERIKDKQFTIGGLLEATEYEFRVFAENE
TGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFG
KELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHP
GYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKN
VQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADD
GGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPL
EVSSVVIIKSPFGKPGAPGKPTITAVTKDSCVVAWKPPVSDGGAKIRNYYLEKREKKQNK
WISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHF
KEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIA
SVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIP
FSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVQRKDAGFYVVCAKNRFGID
QKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLR
VGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDE
TREVSMTKASHSSTKELYEKYMIAEDLGRGEFGIVHRCVETSSKKTYMAKFVKVKGTDQV
LVKKEISILNIARHRNILYLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVS
YVHQVCEALQFLHSHNIGHFDIRPENIIYQTRRSSTIKIIEFGQARQLKPGDNFRLLFTA
PEYYAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQVIENIMNAEYTFDEEA
FKEISLEAMDFVDRLLVKERKSRMTASEALQHPWLKQKIERVSTKVIRTLKHRRYYHTLI
KKDFNMVVSAARISCGGAIRSQRGVSVAKVKVASIEIGPVSGQIMHAVGEEGGHVKYVCK
IENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKFDDGTYRCKVVNDYGED
SSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFG
VTITVHPEPRVTWYKSGQKIKPGDDDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNK
YGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEK
DGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRY
KKQEFKSREEHERHVQKQIDKTLRMAEILSGTESVPLTQVAKEALREAAILYKPAVSTKT
VKGEFRLETEEKKEERKLRMPYDVPEPRKYKQTTIEEDQRIKQFVPMSDMKWYKKIRDQY
EMPGKLDRVVQKRPKRIRLSRWEQFYVMPLPRITDQYRPKWRIPKLSQDDLEIVRPARRR
TPSPDYDFYYRPRRRSLGDISDEELLLPIDDYLAMKRTEEERLRLEEELELGFSASPPSR
SPPHFELSSLRYSSPQAHVKVEETRKDFRYSTYHIPTKAEVSTSYAELRERHAQAAYRQP
KQRQRIMAEKEDEELLRPVSTTQHLSEYKSELDYMSKEEKSRKKSRRQREVTEITEIEEE
YEISKRAQRESSSSASRLLRRRRSLSPTYIELMRPVSELIRSRPLPAEEYEDDTERRSPT
PERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALKTQKTSERKYEVLSQQPFTL
DHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNMSGVLT
LEILDCHIDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASRRRDEEVPRSVFPELTR
TEAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHYASAEMKSAALEEKSLEEKS
TTTKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTMTWLRKGQVLSTSARHQVT
TTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTVQKARVTEKAVTSPPRVKSPE
SRVKSPEAVKSPKRVKSPEPSHPKAVSTTETKPTSTEKVQHLPVSAPPKITQFLKAEASK
EIAKLTCVVESSVLSAKEVTWYKDGKKLKENGHFQFHYSADGTYELKIHNLTESDQGEYV
CEISGEGGTSKTNFQFMGQAFKSIHEKVSKISETKKSDQKTTESTETRKTEPKAPEPISS
KPVIVTGLHDTTVSSDSVAKFAVKATGEPRPTVIWTKDGKAITQGGKYKLSEDKGGFLLE
IHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAVKDTEAQKVSTQKTSEITSQKKAVVQE
EISQKALMSEEIKMSEAKSQEKLALKEEASKVLISEEVKKAAATSLEKSVVHEEITKTSQ
ASEEIRTHAEIKAFSTQMSINEGQRVVLKANIAGATDVKWVLNGIELTNSEEYRYGVSGS
DQTLTIKQASHRDEGILTCIGKTKEGIVKCQYDLMLSKELSDAPAFISQPRSQNINEGQN
VLFTCEISGEPSPEIEWFKNNLPISVSSNVSISRSRNIYSLEIRNASVSDSGKYTIKAKN
FRGQCSATASLMVLPLVEEPSKEVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSS
SASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGKSSMTQLESSTSKMLKAGIRGIPPK
IEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHNQEQQGRFHIENTDDLTTLI
IMDVQKQDGGLYTLSLGNEFGSDSATVNIHIRSI
NT seq 104865 nt   +upstreamnt  +downstreamnt
atgacaactcaagcaccgacgtttacgcagccgttacaaagcgttgtggtactggagggt
agtaccgcaacctttgaggctcacattagtggttttccagttcctgaggtgagctggatt
agggatggccaggtgatttccacttccactctgcccggcgtgcagatctcctttagcgat
ggccgcgctaaactgacgatccccgccgtgactaaagccaacagtggacgatattccctg
agagccaccaatggatctggacaagcaactagtactgctgagcttctcgtgaaagctgag
acagcaccacccaacttcgttcaacgactgcagagcatgaccgtgagacaaggaagccaa
gtgagactccaagtgagagtgactggaatccctacacctgtggtgaagttctaccgggat
ggagccgaaatccagagctcccttgatttccaaatttcacaagaaggcgagctctacagc
ttactgattgcagaagcataccctgaagactcagggacctattcagtaaacgccaccaat
agcgttggaagagctacttcgactgctgaattactggttcaaggtgaagaagaagtacct
gctaaaaagacaaagacaattgtttcgactgctcagatttcagaatcaagacaaacccga
attgaaaagaagattgaagcccactttgatgccagatcaattgcaacagttgagatggtc
acagatggtgccgctgggcaacagctgccacataaaacacctcccaggattcctccgaag
ccaaaatcaagatccccaacgccaccgtccattgctgccaaagcacagctggctcggcag
cagtccccatcgcccataagacactccccttccccggtcagacacgtgcgggcaccgacc
ccatctccggtcaggtccgtgtctccggcagcaagaatctccacatcccccatcaggtct
gttaggtctccattgctcatgcgtaagactcaggcatccaccatggccacaggtcccgaa
gtgccacccccttggaagcaagagggctacgtggcctcctcatctgaggctgagatgaga
gagacaacactgacagcctctactcagatcaggacagaagagagatgggaagggagatac
ggtgtccaggagcaaatgaccatcagtggcgcagcaggggctgttgccactggtgctaaa
gaggtgaaacaagatgctgacaaaagtgcagctgttgcgactgttgttgctgccgttgat
atggccagagtgagagaaccagtgatcagcgctgtagagcagactgctcagaggacaacc
acgactgctgtgcacgtccaacctgctcaagaacagataagaaaggaggcggagaagact
gctgtaactaaggtagtagtggccgccgataaaaccaaggaacaagaattaaaatcaaga
accagagaagtaattaccacaaagcaagagcagatgcacgtaactcatgagcagataaga
aaagaaactgaaaaaacatttgtaccaaaggtagtaatttcggcagctaaagccaaagaa
caagaaactagaatttctggagaaattactacgaaacaaaaacaagtaactcaagaaaca
ataagacaggaaactcagataactgctgcatccatggtggtagttgccactgcaaagtcc
acaaaactagaaacagtcccgggagctcaagaagaaactgctacacaacaagatcaaatg
cacctaagtcatgaaaagataatgaaggaaactaggaaaacagttgtacctaaagtcata
gttgccacacccaaagtcaaagaacaagatttagtatcaagaagtagagaaggcattact
accaaaagagaacaagttcaaataactcaggaaaagatgagaaaggaagctgagaaaact
gccttgtctacaatagcagttgctactgctaaagccaaagaacaagaaacaatactgaga
actagagaaactatggctactagacaagaacaaacccaagttacccatggaaaggtggat
gttggaaaaagggctgaagctgtagcaacagttgttgctgcagtagaccaagcccgagtc
agagagcccagagagcccagagagcctgggcgtcttgaagaatcctatgctcagcagacc
actttggagtatggatataaggaacgcatttccgccgcaaaggtagctgctgagcctccc
caacgtccagcctcagaaccccacgttgtccctaaagcagtcaagcctgtagtaatccag
gctccttctgagactcatattaaaactactgatcaaatgggaatgcacatatcatcacag
atcaagaaaactacagatctaacaacggaaagattagtccatgtggataaacgcccccgc
acagctagccctcactttactgtttcaaaaatttctgttcctaagacagaacatgtatat
gaggcatcaatagctggtagtgctattgccacattacaaaaggagctgtcagccacatct
tctgctcagaagatcaccaaatcggtgaaggctcctactgtgaagcccagtgagactaga
gtaagggcagagcccacaccctcgccacagttcccctttgctgacatgccagatacttac
aagagtcaagctggcgttgaggtgaaaaaggaagtaggggtgagcatcactggtgccact
gtccgtgaagagcgctttgaagtactgcatgggcgcgaagccaaggtaacagaaacagca
agagtaccagcacctgttgaaattcctgttactccaccaactttggtctcgggcttaaaa
aatgtgacagtcatagaaggtgaatctgtcaccttggagtgccacatctctggataccca
tccccaacagtgacatggtacagggaagactaccaaatcgaaagttccattgacttccag
ataaccttccagagtggaatcgctcgtcttatgattcgcgaagcgtttgcggaagacagc
gggcgatttacctgcagtgctgttaacgaggctggaaccgtcagcacatcctgctatctg
gctgtgcaggtgtcagaagaatttgaaaaggaaaccacagccgtgactgagaaatttacc
acagaagagaaacgctttgttgagtcaagagatgtggttatgactgatactagcatcaca
gaggaacaagcagggcctggagaacctgctgcgccttactttattacaaaaccagcagtc
cagaaactggtggaaggtgggagcgtggtgtttggatgccaagttggtggcaacccaaag
ccccatgtgtactggaaaaaatctggtgttcctctgaccactggatacagatacaaagtg
agttacaacaaacaaaccggtgaatgcaagctagtaatttctatgacttttgctgatgat
gctggagaatacactattgttattcgtaacaagcatggagaaacttctgcatctgcttcc
ttgcttgaagaagctgattatgagtcactgatgaagtcccagcaagaaatgctttaccag
acacaagtgactgcatttgttcaagaacccaaagttggagaaacagcccctggatttgta
tactctgagtatgaaaaagagtatgaaaaagaacaagccttaattaggaagaaaatggcc
aaagatactgtaatggtcagaacgtatgtagaagatcaggaattccatatttcttccttt
gaagagagacttattaaagaaattgaatatagaataataaagactacattagaagaactt
cttgaagaagatggagaagaaaagatggcagttgacatttctgaatctgaagctgttgaa
tcaggatttgagttaagaatcaagaattacagaattcttgaggggatgggtgtcactttt
cattgcaagatgtctggatatccattaccaaagattgcttggtacaaagatggcaagcgc
atcaaacatggagaaagataccaaatggactttctacaagatggcagagctagtctgcgt
atacctgttgttcttccagaagatgaaggaatctacactgcatttgccagcaatattaaa
ggaaatgcaatttgctcagggaaattgtatgtggagcctgctgcaccacttggagctcca
acttacatccccacaccagagccagtgagcagaatcagatctctctctccacgttcagtg
agcaggtctcctatacgcatgtctcctgcacggatgtcacctgcaaggatgtctcctgca
cggatgtcccctgcaagaatgtcccctggacgtaggctggaggagacagatgagtcacaa
cttgagagactgtataaaccagtctttgtgttaaaacctgcttctttcaaatgtttagaa
gggcaaactgccagatttgacttaaaggttgttggtagacctatgccagagacgttctgg
tttcacgatggccagcaaattgtcaatgactatacccataaagtggtcattaaagaagat
ggtactcaatcactaattattgtccctgccacacccagtgattctggggaatggactgtg
gttgcccaaaacagggcaggcagatcttcaatttcagtgattttaactgtggaagctgtg
gaacatcaggtaaaaccaatgtttgtagaaaaactgaaaaatgtcaatgtaaaggaaggt
tcccgacttgaaatgaaagtcagagctacgggtaaccccaaccctgacattgtatggttg
aaaaacagtgacatcattgtgcctcataaatatcccaaaatcagaattgaaggaaccaag
ggagaagctgcccttaaaatcgattccactgtcagccaagattctgcctggtatactgcg
actgctattaataaagctggcagagacactacaagatgcaaagtaaatgttgaagttgag
tttgcagagcctgaaccagagagaaagttaatcatcccaagggggacatatagagcaaag
gagattgcagccccagaactggagcccctccatttgcgatatggtcaagagcaatgggaa
gaaggtgatctctatgacaaagagaaacaacagaaaccattcttcaagaaaaaactcacc
tccttaagacttaagcgctttggacctgcccactttgaatgcaggctaacacccattggt
gacccaacgatggtggtggagtggctccatgatggaaagccacttgaggcagccaacagg
ctccgtatgatcaatgaatttgggtactgcagccttgattatggtgttgcatattctaga
gacagtggtatcattacttgcagggccactaacaaatatggaacagatcatacatctgct
acccttattgttaaagatgagaaaagtcttgtggaagaatcccagttgcctgaggggagg
aaaggcttacagagaattgaagaattagagagaatggctcatgaaggtgcacttacaggt
gtaacgacagatcagaaagaaaagcaaaagccagacattgtcttgttcccagagccagtt
agagtacttgaaggggagaccgcaaggttccgctgcagggtaactggctaccctcagccc
aaagtcaactggtacctcaatggacagctcattcgcaaaagcaaaaggttcagagttcgc
tatgatggtatccattacctggacatcgtggactgcaaatcatatgacacaggtgaagtg
aaggtcaccgcagaaaatcctgaaggtgtgatagagcataaagtgaagcttgagattcaa
cagagggaagattttaggtctgttcttaggagagctcctgaaccaaggcccgagtttcac
atacacgaaccaggaaaacttcagtttgaagtacaaaaagtggatagacctgttgacacc
actgaaaccaaagaagttgtgaagttgaaaagggctgaaagaattacccatgaaaaagtg
cccgaagagtcggaagagctgcgcagtaaattcaagcgcagaacagaagagggctattat
gaagccattaccgctgtggagctcaagtctcgaaagaaagatgaatcctatgaggaactc
ctcaggaagacaaaagatgaacttctccactggaccaaagagttaactgaagaggaaaag
aaagctcttgccgaagaaggcaaaatcacgattccaacttttaaacctgataagattgaa
ctaagtcctagtatggaggctccaaaaatcttcgaaagaatccaaagccaaacagtgggc
caaggatctgatgcacacttccgggtcagagtcgtggggaaaccagaccctgaatgtgaa
tggtacaaaaatggtgtcaaaattgaacggtctgaccggatctactggtactggccagaa
gacaatgtttgtgaattggtcataagagatgtgactgctgaggactctgccagcatcatg
gtaaaagccatcaatatagctggagaaacctccagtcacgcattcttacttgtccaagcc
aagcaattgatcactttcacacaggaattacaagatgttgttgctaaggaaaaagacact
atggcaacctttgaatgtgaaacttcagaaccatttgttaaagtgaaatggtataaagat
ggtatggaggttcatgagggagataaatacaggatgcactctgacagaaaggttcacttc
ctctccatactgaccattgatatgtctgatgctgaagattacagctgtgtgcttgtagaa
gatgaaaatatcaaaacgactgctaaacttattgttgaaggtgcagttgttgagtttgtg
aaggaacttgaggacatagaagttccggaatcgtattcaggagaattagagtgtattgta
tccccagaaaatatagaaggaaaatggtatcataacaatgtggagcttaaatccaatggc
aaatacacaattacatctcgtcgtggacgtcagaacctcacagtcaaggacgtaaccaag
gaggaccagggagaatacagctttgtcattgacggaaaaaagacaacctgtaaactaaag
atgaaaccccgccccattgctatcctacaaggacttagtgaccaaaaagtctgcgagggt
gacattgttcagcttgaagttaaagtctccttggaaagtgtggaaggcgtctggatgaaa
gacggccaagaagtgcagcccagtgacagggttcacattgtgatagacaaacaatctcat
atgctgctcattgaagacatgactaaggaagatgctggaaattactctttcaccattcca
gcccttggcctctccaccagtgggcgtgtctctgtctatagtgtggacgtgataacacct
ctaaaagatgttaatgtgattgaaggcacaaaggctgtgcttgaatgtaaggtctcagtc
cctgatgtgacttctgttaagtggtacttaaatgacgaacaaatcaagcctgatgaccgt
gtgcatgccattgtaaaaggtactaaacagcggctagtcattaaccgaactcacgcttca
gacgaaggaccttacaagctgatagttggcagagttgaaaccaactgtaatctctctgta
gaaaaaattaaaattatcagaggtcttcgtgaccttacctgtacagaaactcaaaatgtg
gtgtttgaggttgagctgtcccactctggaattgatgtcttgtggaattttaaggacaag
gaaatcaaacccagttctaaatataaaatcgaagcacacggaaaaatatataaattgaca
gttctaaatatgatgaaagatgatgaaggaaaatatgcattttatgcgggagaaaatatg
acatctggaaaacttactgtggcaggtggggccatctccaagccactcacagatcagact
gtagctgaatcccaggaagctgtgtttgaatgtgaagttgccaacccagattccaaaggc
gaatggttgagggatggcaaacacctaccactgactaacaacatcagaagtgagtctgat
ggccacaaaaggagacttatcattgctgccaccaaattagatgacattggagaatatacc
tacaaggtggccacctccaaaacatctgccaaactcaaagttgaagctgtcaaaattaag
aagactctgaagaacctcacagtgacagaaacacaggatgctgttttcactgtcgagctt
acacaccctaatgtcaaaggtgtccagtggatcaaaaatggagttgtgctggaatccaat
gaaaagtatgctatctctgttaaaggaacagtttattctctgaggattaaaaactgtgcc
atcgtggatgagtctgtttatggcttcaggcttggaaggctaggagccagtgccagactg
catgtggagactgtcaagatcattaaaaagccaaaggatgtgacagccttggaaaatgcc
actgttgcctttgaagttagtgtttcccatgacaccgttccagtaaaatggttccataag
aatgtggaaattaagccaagtgacaaacacagactggtctcagaaaggaaggtccacaag
ctgatgctgcagaacatctccccctcagatgctggggaatacacagctgtggtggggcaa
ttggaatgcaaagcaaaactgtttgtggagacattacatattacaaaaaccatgaaaaat
atcgaggtgcctgagaccaaaactgcctcttttgagtgtgaggtgtctcacttcaatgtc
ccttccatgtggctgaagaacggtgtggaaattgagatgagtgaaaagttcaagatagtt
gtgcagggaaaactccaccagctgatcatcatgaacaccagcacagaggactcggcggaa
tacacatttgtctgtggcaatgaccaagtcagcgccaccctgacagtcaccccaatcatg
attacttccatgctgaaagacatcaatgctgaagaaaaagacactattacttttgaggtg
acagtgaactatgaaggcatctcttacaaatggttaaagaatggtgtggaaatcaaatca
actgacaagtgccagatgagaaccaaaaagcttacacactcactgaacatcaggaatgtt
cactttggggatgctgctgactacacctttgtagctggaaaagctacatcaacagccaca
ctttatgtggaagctcgtcatatagaatttaggaaacacattaaggacattaaggttctg
gagaagaagcgagccatgtttgaatgtgaagtttctgaacctgacatcactgtacagtgg
atgaaagatgaccaggaactgcagatcacagacagaataaagattcagaaggagaaatat
gtccaccgccttctgatcccatccaccaggatgtctgatgctgggaagtacacagtggtg
gcaggaggcaacgtgtcaactgcaaacctctttgtagaaggcagagatgttcgcatccga
agtattaaaaaggaggttcaggtcattgagaaacagcgtgctgttgttgagtttgaggtc
aatgaagacgatgttgatgcccactggtataaagatggcattgaaatcaatttccaagtt
caagaacgacacaaatatgtggtggagagaagaatccaccgaatgtttatctctgagacc
agacagagcgatgcaggagaatacacctttgtggcaggaaggaacaggagttctgtcact
ctctatgtcaatgctcctgaaccgccccaagttctgcaggagctccagcctgtcactgtg
cagtctggcaagccggcccgcttctgtgccgtgatatctggcagaccacagcccaaaatt
tcctggtacaaggaagagcagctgctttccactggcttcaagtgcaaatttcttcatgat
gggcaagagtacacgcttttgctaattgaagccttcccagaggatgcggcagtctatacc
tgtgaagccaagaatgactatggagttgccacaacatcagcttcactctcagtggaagtt
ccagaaattgtgtctcccgatcaggaaatgcccgtttatccacctgccatcatcaccccg
cttcaggacactgtcacttctgaagggcagccagcccgttttcaatgccgggtttctgga
acagatctaaaagtgtcttggtacagcaaagacaagaaaatcaagccatctcggttcttt
agaatgactcaatttgaagacacttaccaactggaaattgccgaagcttatccagaagat
gaaggaacttacacgtttgttgctagtaatgctgtaggccaagtgtcaagcacagccaac
ctgagtctggaagcccctgaatcaattttgcatgagaggattgaacaagagattgagatg
gaaatgaaagagttttctagttcttttctgtctgccgaggaagaaggacttcatagctct
gaacttcatttatctaatataaatgaaacacttgaacttttgtctgaacctccagtttac
tcaactaaatttgattccaaaaaggaaggcgctgtcccagttttcatcaaagaagtgtca
agtgctgatacaagcatgggggatgtggctacactgtctgtaactgtcattggcatcccc
aaacctaaaattcaatggttctttaatggagcgccattaaccccttctgctgactacaaa
tttgtttttgacggtgatgatcatagcctgatcattctgttcaccacattggaggatgag
ggagagtatacatgtatggccagtaatgactacggacaggcaatatgtagtgcctatcta
aaagtaaattccaaaggagagggtcacaaagacacagaaacagaatcagcagtggcaaaa
tctctggaaaagcttggaggtccttgtcctcctcacttccttaaggagttaaaaccagtt
cgctgtgctcaaggacttcctgccatctttgagtacacagtggttggagagcctgcccct
accgttgcatggttcaaagaaaacaagcagctttgcaccagtgtttattacactatcatt
cataaccctgatggctctgggactttcattgtcaatgaccctcagagggaagacagtggc
ctctatatctgtaaagcagagaatatgctgggtgagtccacctgtgcagcagagcttctt
gtgcttctggaagacacagacatgactgataccccctgcaaagcaaagtccacaccggag
gctcctgaggattttccacagacaccattaaagggtcccacagttgaagcacttgactca
gagcaggaaattgcaacatttgtaaaagacaccattttgaaagctgctttaattacagaa
gaaaaccagcaactatcttatgagcatattgctaaagccaatgaattgagcagtcagctt
cctttgggagctcaggaattacaatccattttgaagcaagacaagtccactcctgaaagc
accagggaatttctttgcatcaatggcagtactcactttcagcctctcaaggaaccctct
cccaacctacagctgcagattgtacagtcccagaaaaccttctccaaagaaagcattcta
atgcttgaagaacctgagacacaggcggttctatcagagactgataaaatcttcccaagt
gccatgttcatagaacaaattaattcattaacagttgagcctctgaaaactttattaact
gaacctgaagggaattatccacagtcttcaatagaacctccagtgcattcttatctaacc
tctgtgtctgaggaagtgcttttaccaaaagaaaagacagtatctgatgccaacaaagac
caaagagtgactgttcaaaagcaaggggcacaaagtgcactcatcttgagtcagagctta
gctgagggacatgtggagagtctccagagtcctgatgtcatgatctctcaggtaaactat
gagcccctagtcccttcagaacactcatgcacagaaggagctgaaattttgatagaaagt
acagatccactggaaaatgcagggcaagattctgcggtcagaattgaggaaggcaagtcc
ttaagatttccgctagcacttgaagaaaagcaggtactgctcaaagaagagcattctgac
aacatggtgatgcccccagaccaaatcattgagtctaaaagagagcctgtggcgataaag
aaagtgcaggaggtacagggaagggacattctttctaaggaaagcttgctttctggtatt
ccagaagagcagcgattaaatctgaaaattcaaatctgcagggctttgcaagcagctgtg
gccagtgagcagccaggtcttttctctgagtggctaagaaacattgaaaaggtggaggtc
acagctgtaaacatcacccaagagcccagacacatcatgtgcacgtaccttgttacttca
gcgaagtctgtaacagaagaagtaaccatcattattgaagatgttgatcctcaaatcact
aacctgaaaatggaacttaaggatgttttgtgtgctattatatatgaggaaataagcatc
ctaacagctgagggtcctagaattcagcaaggagccaagacaagtttgcaggaagaaatg
gattctttttcaggttcacagaaggttgaacccattactgaaccagaagttgaatctaaa
tatcttatctcatctgaagaggtcagttattttaacgtgcaaagtcaggttaaatatttg
gatgccacaactgtcactaatggggttgcttcagctgttgtctctgatgagaaacaagat
gagagtctgaaaccatcagaggaaaaagaggagtcctcctctgaaagtggtactgaggag
gttggtacagtaaagatacaggaagctgagggtggcttaatcaaagaggatggccccgtg
atacatacacccttaatggacactgtttctgaggaaggtgacattgtacacctcacaaca
tccataacaaatgctaaagaggtgaattggtattttgagaataaactggtgccttcagat
gaaaagttcaagtgtttacaagatcaaaatacgtatacgctagtcatcgacaaagtaaat
accgaagaccatcaaggagagtatgtctgtgaggccttgaatgacaacggaaaaacagca
acttcagccaaactcactgtagtaaaaagagctgccccagtgatcaggaggagaatcgaa
cccctggaagtagcactgggccacctagccaaattcacctgtgagatccaaagtgctccc
aatgtccggttccagtggtttaaagctggccgagaaatttatgagagtgacaagtgttct
attcgatcttcaaaatatgtctccagccttgaaatcctaagaacccaggtggttgactgt
ggcgagtatacgtgcaaagcttccaatgagtatggcagtgtcagctgtacagccacacta
actgtgacagaggcatatccaccaacctttctctccagacctaagtcccttacgactttt
gtgggtaagtcagccaagttcctctgcacagtgacagggactcctgtgatagaaaccatt
tggcagaaagatggtgctgcactctcaccttcacctaaccggaagatttccgacgcagaa
aacaaacacattttagaactctcaaaccttaccattcaagatagaggagtttattcttgt
aaggcttctaacaaatttggagcagacatctgccaagcagagttggtcatcattgataag
ccacatttcattaaagaattagagtctgtgcaatctgctatcaataagaaggtccgcctt
gagtgccaagtagatgaagacagaaaagtcacagttacgtggaacaaagatgggcaaaaa
ctccccccagggaaagattataagatctgttttgaagataaaatagcaacacttgagatt
cctctggccaaactgagagattcaggaacctatgtctgtatagcttcaaatgaggctgga
agcagctcctgttcagccacagtcactgtcagagaaccaccatccttcgtgaagaaggtg
gatccctcttatttaatgctgccaggtgaatcagcacgcctccattgcaagctgaaaggc
tcacctgtgatccaggttacttggtttaaaaataacaaagaactcagtgaaagtaacaca
gtccgaatgtattttgtcaattctgaggccatacttgatattacggatgtaaaagttgaa
gacagtgggagttactcatgtgaagcagtgaatgacgttggcagtgatagctgcagtact
gaaatagttatcaaagaacctccttctttcatcaaaactcttgagcctgcagacatagtg
agaggaacaaatgctctacttcaatgtgaaatctcaggcactggaccatttgaaattagc
tggtttaaagataagaaacaaattcgaagtagtaaaaaatacagattgttttctcagaag
tctcttgtgtgtctggagatcttttcttttaatagcgcagatgttggtgactatgaatgt
gttgttgctaatgaagttggcaagtgtggctgcagggcaacacacttactcaaagaacct
ccaaccttcgtaaagaaagtagatgattttattgcactagcaggacaaactgttaccctg
caagctgctgtgagagggtcagaacccatttctgtcacatggatgaaaggacaagaggtc
attagagaagacggaaaaatcaaaatgagcttttccaatggtgttgcagtcttgataatc
cctgatgtgcagattagttttggaggcaaatacacgtgcctggctgaaaatgaagctgga
agccaaacatctgttggggaattaatagttaaagaacctgccaaaatcattgagcgagca
gaactgatccaggtgacagcaggagatcccgccacactggagtacacagtgacaggcacg
ccagaactgaagcccaaatggtacaaagatgggagacccttggtcgccagtaaaaaatac
cgaataagttttaaaaacaatgttgcccagctcaaattttattcagctgagctgcacgat
agtggccaatacacatttgagatttccaatgaagtgggcagcagctcctgtgagactaca
ttcactgtattagatcgagacattgctccattttttaccaaacccttgcgcaacgtggat
agtgttgttaatggtacctgcagactggactgcaaaattgcaggctccctccctatgagg
gtgtcctggtttaaggatggcaaagaaataacttcttctgacagatacaggatagcattt
gtggaaggcacagcttctttggagatcatcagagtagacatgaatgatgcagggaatttc
acttgtcgagccacaaattccgtgggaagcaaagacagcagtggagccctgattgtgcaa
gaaccacccagttttgtaattaaacccggctcaaaggatgttctgcctggctcagcagtc
tgcctgaagagcactttccaaggatctactcctctcacaatcagatggtttaagggcaac
aaagagctggtttctggtggaagctgctatatcaccaaagaagctttagagagttccttg
gaactttatgcagtaaaaacctctgattcaggcacatacacatgtaaagtcagcaatgtc
gctggaggcgtggaatgcagtgcaaacttgtttgtaaaagaacctgccacatttgttgaa
aagttagagccatcacagctgttaaagaagggagatgccacccagctagcctgcaaagta
actggtacccctccaattaaaataacatggtttgcaaatgatagagaaattaaggagagc
agcaaacacagaatgtcttttgtggagtctgctgcagttctaaaactgacagatgttggc
atcgaagacagtggtgaatatatgtgtgaggcccagaatgaggctggcagtgaccactgc
agtagcattgtaatagtcaaagagtcaccttactttaccaaggaatttaaaccaattgaa
gtcttaaaggagtacgatgtcatgttgctggctgaggtggcaggcactcctccctttgag
atcacttggttcaaagacaacacaaccctgcgaagtggtagaaagtttaagaccttcatt
caggatcatctggttagcctgcagatcctcaagtttgtagctgcagatgctggtgaatac
cagtgtcgggtgaccaatgaggtgggcagcagcatctgcagtgccagggtgactttaaga
gaacccccatccttcataaagaagatcgagagtaccagctccctccgaggaggcacagct
gccttccaggccactctgaagggctccttgccaattatggtgacttggctaaaagacaac
gatgaaatcactgaagatgataacataagaatgacctttgagaacaatgtggccagtttg
tacctcagtggcattgaagtcaagcatgatgggaaatatgtctgtcaggccaaaaatgat
gcaggaatacaaagatgttctgcattactctcagtaaaagaacctgcaacaatcaccgag
gaagctgtgtctatagatgtcacccatggagacccagccactttgcaggttaaattttca
gggactaaggagattacagccaaatggtttaaagatggccaagaactgaccctgggctca
aaatataaaatcagtgttactgatacagtctcaatactgaagattatttctacagaaaag
aaagatagtggagaatatactttcgaggtccaaaatgatgttgggaggagcagctgcaag
gctagaattaatgtattagatcttatcatacctccttcattcaccaaaaagctgaagaaa
atggacagcattaaaggctctttcattgacttagaatgtatagtggctgggtcacatccc
ataagcatccagtggttcaaagatgaccaagaaatatcagctagtgaaaagtacaaattc
tcttttcatgacaatactgccttcttggaaatcagtcaactggaaggtacagacagtggg
acatacacttgttctgccaccaataaggcagggcacaaccagtgcagtgggcatctgaca
gtcaaagaacccccttattttgtggaaaagccacagtcacaagatgtcaatcccaacaca
agggttcagttaaaggctcttgtgggtggcactgcacccatgacaataaagtggtttaaa
gataacaaagagctacactcaggagcagcccgctcggtttggaaggacgacacctctacc
attctagagctctttgcagccaaagctactgattccggaacctacatttgccaactaagc
aatgatgttggcacagcaaccagtaaagtcactctctttgtaaaagaacctcctcaattc
attaagaagccaagtccagtcttagtgctgaggaatggacagtcaacaacatttgaatgc
caaataacaggcactcctgaaattcgagtgtcttggtatctagatgggaatgaaataaca
gctattcagaaacatggcatttccttcattgatggtttggccactttccagatttctagt
gccagggtagaaaatagtgggacttatgtctgtgaagctcgaaatgatgcgggcacggcg
agctgcagcattgaactcaaagtgaaagaacctcccacctttatcagagagctgaagcct
gtggaggtagtaaaggatagtgacatggagctggaatgtgaagttacaggaacacctccg
tttgaagtcatttggctgaggaataacaaggaaattcgaagcagcaaaaaatacacgttg
actgacagagtgtctatttttaacctccatataaccaagtgtgacccttcagacactggg
gaataccagtgcattgtatccaatgaaggtggcagctgctcttgcagtgctagagttgcc
ctgaaagaaccaccatcgtttattaagaagatagaaaataccactactgttttgaaaact
tctgccacttttcagagtatcgtggcaggttctcctcctatttctataacctggctaaag
gatgatcaaattcttgatgaagatgataacatctatatttcatttgtggacagtgtggcc
acacttcaaatcagaagtgtggataatggacacagtgggagatatacgtgtcaagccaag
aatgagtcaggagttgagaggtgttatgctttccttttagtacaagagccagctcaaatc
atagagaaagctaaatcagttgatgttacggagaaagatcccgtgactttggaatgtgtt
gtggctggaacaccagaactcaaagtgaaatggcttaaagatgggaaacaaatagttccc
agtagatacttttcaatgagttttgaaaacaacgtggccagttttaggattcagtcagta
atgacgcaggacagcggtcagtatactttcaaggtggaaaatgactttggaagcagtagc
tgtgatgcctacctaagagtgctagatcaaaatattcctccatcattcaccaaaaaatta
accaaaatggataaagttctgggctcttctattcatatggagtgcaaggtttctggttca
cttcccattagtgctcagtggtttaaggatggaaaagaaatatccacaagtgcaaaatac
agacttgtatgccatgagagatctgtgtctctagaagttaataatctggaattagaagat
actgcaaattacacatgcaaagtgtcaaatgtagcaggcgatgatgcatgcagtggcatc
ttaactgtgaaagaaccaccaagcttcctagtgaaacctgggcgacaacaagccatacct
gattctacagtggaattcaaggcagtactaaaaggaacaccaccatttaaaataaaatgg
tttaaggatgatgtggaacttgtctcaggtcctaaatgtttcattggcttggaagggtcg
actagcttcttaaatctctactcagtggatgcttctaagactggacagtatacttgccac
gttaccaatgatgttggtagcgactcttgtactacaatgttacttgtgacagaaccacca
aaatttgtaaagaaattagaagcatccaaaattgtgaaagcaggtgactcttcacgactt
gaatgcaagatagctggatccccagaaatcagagttgtatggttccgaaatgaacatgaa
cttccagccagtgataagtacagaatgactttcattgactcagtggctgtcctacagatg
aacaatctcagtactgaggacagtggagatttcatttgtgaggctcagaatcctgctggc
agcacaagctgcagtaccaaggttatagtaaaagagccacctgtttttagcagcttccct
cctgtagtagaaacccttaaaaatgctgaagtcagtcttgaatgtgaactttcgggaaca
ccaccgtttgaggtggtgtggtacaaagacaagcggcaactcagaagcagcaagaaatac
aagattgcatccaaaaacttccacacaagtattcacattctcaatgtggacacttcagac
atcggtgaataccactgcaaagcacataatgaagtgggaagtgatacttgcgtttgtact
gtaaaactgaaagaaccaccaagatttgtctccaaactgaacagcctcgctgttgtagct
ggagagcctgctgaattacaagcatccatagaaggcgcccagcctatttttgtccagtgg
cttaaagagaaggaagaagtgattagagaaagtgaaaacatcaggattacatttgtggaa
aatgttgcaactctgcagtttgcgaaagcagagccagctaatgctggaaagtatatctgc
caaatcaagaatgatggtggaatgagggagaacatggccacactgaccgtcttagagccc
gcagtcattgttgagaaggcaggaccgatgacagtgactgtaggagaaacgtgcactctg
gagtgtaaggtggctggcactccggaactctctgttgaatggtacaaggatggaaagctg
ttgaccagcagccaaaaacacaaatttagcttctacaacaaaatctcttccttaaagatt
ctctcagttgaaaggcaagatgcaggcatatacactttccaggttcaaaataatgttggg
aaaagcagctgcacagctgtagttgatgtttcagaccgaacagttcctccctctttcaca
cgaagactgaaaaacactggtggggtgttaggtgcctcttgcatcttggaatgcaaagta
gctggatcatcacccatctcagttgcctggtttcacgaaaaaactaagattgtcagtgga
gcaaagtaccagaccgcattttcagataatgtctgcacattgcagttgaattctctggat
tcatcagatatgggcaattacacatgtgtggctgctaatgtcgctgggtctgatgaatgt
cgcgcagtgctaactgtacaagaaccaccctcttttgtgaaagaacctgaacctttggaa
gtactaccagggaaaaatgtaaccttcacaagtgttattagaggaacccctccattcaaa
gttggctggttcagaggtgccagagaactagtgaaaggagaccagtgtaacatctatttt
gaagacactgtggcagaactggaattatttaatatcgacatatctcagagtggggaatac
acctgtgtggtttctaacgacgctggccaagcatcttgcactacccgtctctttgtaaaa
gaaccagctgcatttgtgaagagattaagtgatcattctgtagaaccagggaagtccata
attctggagagcacctatactggaacacttccaatttctgtcacttggaaaaaggatggt
tttaacataactacctctgaaaaatgtaacatagtcacaacagagaaaacttgtatcctg
gaaattctgaatagcacaaaaagagatgcaggacggtattcctgcgagattgaaaatgag
gcaggaagggatgtttgtggagctctggtatctacattagaaccgccttattttgttacg
gaactggaacctctggaggcatcagttggagatttggtttctttacaatgccaagttgct
gggacaccagaaattacagtgtcttggtacaaaggagacaccaaattacggccaactcct
gaatacaggacctactttacaaacaatgtggccacgcttgtttttaataaggtgaacctc
aatgacagcggagagtacacatgcaaagcagaaaatagtataggaactgcttcttctaag
actgtgttcagaattcaagagcgccaactcccaccttcctttgcaagacaattaaaggac
attgaacaaactgtggggttacctgttacactcacttgccgattaaatggctctgcaccc
atccaagtgtgctggtatagagatggagtacttttaagagatgatgaaaatctacagaca
tcatttgtagataatgtggcaactttaaaaattttgcaaactgacttgagtcactctggc
cagtactcttgctcagcttccaacccactcggaacagcatcttctagtgctagactcaca
gcaagagaacccaagaaatctcccttctttgacatcaagcctgtgtctatagatgttatt
gctggagaaagtgctgattttgagtgtcatgttactggtgctcaaccaatgcgaatcact
tggtcaaaagataacaaggagattcgtcctggaggaaactatacaatcacatgtgtggga
aacactcctcatttgagaattcttaaagtaggcaaaggagactctggtcaatatacttgc
caagcaaccaatgatgttggcaaagacatgtgctcagctcagctcagtgtaaaagaacct
ccaaagtttgttaagaaattagaagcttcaaaagttgcaaagcagggagaatccattcaa
ctggaatgtaaaataagtggttccccagaaatcaaagtttcatggttccgaaatgacagt
gaacttcatgaaagttggaaatacaacatgtcattcattcattctgtggcattgcttacc
atcaatgaagctagtgctgaggacagcggggactacatttgtgaggctcataacggtgtt
ggtgacgccagctgcagcacagcgttgacagtgaaagcacctcctattttcacccagaag
ccttctccagtaggagctcttaaaggttctgatgtgattctacaatgtgaaatttcggga
actcccccatttgaagtagtatgggttaaagatcgaaagcaagttagaagcagcaagaaa
tttaaaatcacttcgaaaaattttgatacaagtcttcatatccttaaccttgaagcctcc
gatattggggaatatcactgcaaagctactaacgaggtgggaagtgacacgtgttcttgc
tctgtcaagttcaaagaaccgccacgattcgtgaaaaagctaagtgacacctcaacactt
attggggatactgttgagttacgggccatagtggagggcttccagccaatttctgttgtc
tggctgaaagataaaggtgaagtcatcagagaaagtgagaacaccaggatttcattcatt
gataacattgcaaccctccagctgggaagtccagaagcatctaattctggaaaatatata
tgccaaatcaaaaacgatgctggaatgagagaatgctctgcagtcttgactgtactagaa
ccagccagaatcatagagaagccagaacccatgactgtaactactggaaatccttttgca
ttagaatgtgtagtgactggaacacccgaactctcagccaagtggttcaaagatggaaga
gaattgtctgcagacagcaaacatcacattacattcatcaataaagtggcttcccttaaa
atcccctctgcagaaatgagtgacaaagggttatatagctttgaagtgaaaaacagtgtt
ggcaaaagtaactgcactgtatctgtccatgtttctgatcggattgtgcctccttccttc
atccgcaagctgaaagacgtgaatgccatcctgggggcctcaattgttttggagtgccga
gtctctggttcggcccctatttcagttggctggtttcaggacggaaatgagattgttagt
gggcccaaatgtcagtccagcttttcagaaaacgtctgtactttgaatctgagcttgttg
gagccctccgacacaggcatatacacgtgtgtggctgccaacgtagctggttccgatgag
tgctcagcagtcctgactgtgcaagaaccaccatcttttgaacaaacccccgattctgtg
gaagttttgcctggaatgagcctcacattcaccagtgtcatcagaggcacccctcctttc
aaggtcaagtggtttaaaggcagcagggaactggtgcctggggagtcatgcaacatctcc
ctggaagattttgtcacagaactggagttgtttgaggtgcagccattgcaaagtggagac
tattcttgcctcgttactaatgatgctggcagtgcttcctgtaccacacatctttttgtg
aaagaaccagccacctttgtgaaaagactggctgatttcagtgttgagacaggaagcccc
atagttctcgaggccacatacactggcacacctccaatctcagtgagctggataaaggac
gagtatcttctttcacaatctgagagatgcagtattactatgacagaaaaatctaccata
ctggaaattcttgagagcacaatagaggattatgcacagtacagctgcctgatagaaaat
gaggccggtcaagatatctgtgaagctctggtggctgtcttagaaccaccatacttcacc
gaacctctggaacatgtggaagcagccattggagaacctgcaactttacagtgtaaagtg
gatggaactccagaaattagaatttcttggtataaagaacacacaaagctacgatcagct
cctgcatataaaatgcaattcaaaaataacattgcttccttagtaatcaacaaagtggat
cacagtgatgtgggagagtattcgtgcaaggcagagaacagtgtgggggcagtcgcttct
tcagctgtgcttgttatcaaagagcgcaaacttccaccttcctttgcaagaaaactgaaa
gacgttcatgagactctaggcttcccagttgcatttgaatgccgcatcaatggctcagaa
ccacttcaagtgtcttggtacaaggatggggttcttttgaaagatgatgctaatttgcag
acatcttttgttcataatgtagcaactcttcagattttacaaactgaccagagccacgta
gggcagtataattgctctgcttctaatcctcttgggaccgcttcgtccagtgccaggctc
attctctcagagcatgaagtgcctcctttctttgatctaaagcctgtatcagtagatctt
gctcttggagaaagtggtacttttaaatgtcatgtaactgggactgcaccaatcaaaatc
acttgggccaaagataaccgagagatacgccctggaggcaactacaagatgactttggta
gaaaatactgccactctgacagttctcaaagtaggcaaaggtgatgccgggcagtacacc
tgctatgcaagcaacgtcgctggaaaagactcttgttctgctcagctgggtgtacaagaa
ccacccaggttcattaagaagctagaaccttcaagaattgtgaaacaggacgaattcaca
aggtatgaatgcaaaatcggcgggtctccagaaatcaaagttttatggtacaagaacgag
actgaaattcaagagagcagtaaattcagaatgtcatttgttgactcggtggctgtgctg
gaaatgcacaatctcggtgttgacgacagtggagactacacctgtgaggcccacaatgca
gcaggcagtgccagcagcagcacgtccttaaaagttaaagaaccacccattttccgcaaa
aagcctcatcctgtcgagacactgaaaggagctgatgttcaccttgaatgtgagcttcag
ggcacgcccccatttcatgtttcttggcataaagacaagagagaacttaggagcggcaag
aagtacaagataatgtctgagaatttccttaccagtatccacatcctgaatgttgatgct
gcagacattggggaataccagtgtaaagccacaaacgatgtggggagtgacacttgcgtt
ggttccatcactctcaaagcaccaccaagctttgtgaagaagctcagtgacattactact
gtcgttggtaaagaagttcagctgcagactatcattgaaggcgctgagcccatttcggtg
gtgtggttcaaagataagggggaagtcgttagagaaagtgacaacacatggatttcttat
tcagaaaacattgcaaccttacagttttcaagagtggaaccagccagtgctggaaaatac
acttgtcagatcaaaaatgatgctgggatgcaagagtgcttcgccatgctatccattctc
gagcctgcaacaattgtagaaaagccagaatccataaaagttaccacgggagacacctgt
accttggagtgtacagtagctggcacccctgaactcagtactaagtggtttaaggatgga
aaagaactaacaagtgacaacaaatacaaaataagcttcttcaacaaagtatcttgcctt
aagatcatcaaggtggcaccgagtgacagtggggtatacagttttgaggtgcagaaccct
gttggtaaagacagctgcacagcttcagtgcaggtttcagaccgaaccactcctccttca
ttcacaagaaaattgaaagagacaaatggtctatccggttcctcagttgtaatggagtgt
aaagtctatgggtcacctccaatctctgtctcctggttccatgaaggaaatgagatcagc
agtggaaggaaataccagaccaccctgacagataatacttgtgctttaactgtgaacatg
ctggaagaatcagacagtggtgactacacatgtatagctactaatatggctggttctgat
gaatgtagtgctcctttgactgtgagagaaccaccatcttttgttcagaaacctgatccc
atggatgttttaactgggaccaatgtaactttcaccagtatcgtaaaaggaacacctcct
ttcaatgttagctggttcaagggtagcagtgaagtagtaccaggggacagatgcaacgtg
tccttggaggattcagttgctgaactggaattgttcgatgtagatacatcacaaagtgga
gaatatacttgcatagttagcaatgaagctggcaaggcttcttgtacaacacatctctac
ataaaagccccagccaaatttgtgaagaggctgaatgattacagcatagagaaaggaaaa
gccctgatcctagagggtacattcactggaactcctcccattttggttgtctggaagaaa
aatggcataaatgtaactccttctcagaggtgtaatataactacaactgaaaaatcagca
atcctggaaattccaagtagcacagtagaggatgcaggacaatacaactgctacattgaa
aatgcttctggaaaagattcctgttcagcacaaatactcatactagaaccaccgtatttt
gtcaagcagctggagccagttaaggtgtctgttggagattctgcctctctacaatgccag
cttgctggaacccctgaaattggggtatcctggtataaaggagatacaaaattgagaccc
actacgacctacaaaatgcattttaggaataatgttgctacactggttttcaaccaggtt
gatattaatgatagtggagaatatatctgcaaagctgaaaacagcgtgggagaagtttct
gcatcaactttccttaccgttcaagagcaaaaacttccaccatcattttctcgacaattg
agagatgttcaagaaacacttggactgccagttgtttttgattgtgccataagtggatca
gaacctatctctgtgtcttggtataaagatggcaagccattgaaagacagcccaaatgta
caaacatcatttttggacaatacagccacactcaatatttttaaaactgaccggagcctt
gcaggccagtattcttgcacagctacaaaccctataggctctgcttcttctagtgcccgg
ctcattcttacagaggggaagaacccacccttctttgacatccctcttgcccctgtggat
gctgtggtgggagaaagtgctgactttgagtgccacgtcatgggcacacaaccgataaag
gtcagctgggccaaagacaacagagagatacgaagtggcggaaactaccagattagttat
ctggaaaacagcgcccgcctgacagtcctcaaagtagacaaaggagattctggacgatat
acctgctatgctgtgaatgaagtgggaaaagactcttgcacagctcagctgaatataaaa
gagcggctcatcccaccaagtttcactaaaaaactctcagagacagtagaagaaacagaa
gggaattcttttaaacttgagggacgtgtggctggttcccaacctataactgttgcctgg
tacaaaaataatatagagatacaaccaacttctaactgtgaaataacattcaagaacaac
acgttagtgctgcaagtcaggaaagcaggcatgaacgatgcgggtttgtacacatgcaaa
gtgtccaatgatgcaggctctgctctgtgcacatcttcaattgtcatcaaagaacctaag
aagccacctgtatttgatcagcaccttactccagtaacagtgagtgaaggagaatacgtg
cagctcagctgccatgtccagggatctgagccaattaggatccagtggttgaaggctggc
agggaaataaagccttcagacagatgcagcttcagctttgctagtgggacagctgtactg
gaactcagagatgtgactaaagcagattcgggagattatgtgtgtaaagcttcaaatgtg
gctggaagtgacactaccaaatcaaaagtgaccattaaagacaaaccagctgtggcccca
gcagccaagaaagctgcagtagatggaagactcttttttgtgtcagaacctcagagtatc
agagtcgtagaaaaaaccactgcaaccttcattgcaaaagttggaggtgacccaatccca
aatgttaaatggacgaaagggaagtggagacagctgaaccaaggaggtcgtgttttcatc
caccaaaaaggcgatgaagcaaaactggagattagagacaccacaaaaactgattctggg
ttataccgatgcgtggcatttaacaaacatggtgaaattgaaagtaatgttaacttacag
gtggatgaaaggaagaaacaagagaaaattgaaggcgatcttagagcaatgctgaaaaag
actccaatcttaaagaaagctggggaagaagaggaaattgatatcatggaacttctcaaa
aatgttgatcctaaagaatatgaaaaatatgcccgcatgtatggaatcactgacttccga
ggtcttcttcaagcatttgaactgctcaagcaaagccaagaagaagagacacatagactg
gaaattgaagaaatagagaggtcagagaaggacgaaaaggaattcgaggaacttgtatca
tttattcagcaaagactgtcacagacagagcctgtcactctgatcaaggacatcgaaaat
cagacagttttgaaagataatgatgctgtctttgaaattgacattaaaattaattatcca
gaaatcaagctttcgtggtacaaaggaactcaaaaactggaacccagtgataaatttgaa
ataagcatcgatggtgaccgacatacactcagagtcaaaaactgtcaacttaaagaccag
ggcaattatcgattggtttgtggcccacacatcgctagcgctaaactgactgtaattgag
cctgcatgggaacggcatcttcaggatgtgactctgaaagaaggccagacttgcaccatg
acatgccagttttctgtaccaaatgtaaaatctgaatggttcagaaatggcagaatcctt
aaaccccaaggtagacataaaacagaagtggaacacaaagtccacaaattgaccattgca
gatgttcgagcagaagaccagggtcagtacacctgcaaatatgaagaccttgaaacttca
gcagaactcagaatcgaagctgaaccaattcagtttacaaagcgtatacagaacattgtg
gtgagtgagcatcagtctgccaccttcgagtgtgaagtgtcctttgatgacgccattgta
acatggtacaaaggaccaacagaactgacagagagccagaagtacaactttaggaatgac
ggtcgctgccattatatgaccatccacaacgtgaccccagacgatgaaggtgtctactcg
gtcatcgctcggctggagccaagaggtgaagcaagaagcacggcagagttgtacctaacg
acgaaagaaatcaaacttgagctgaagcctcctgatattcctgactccagagtcccaatc
ccaaccatgcctattagagcagtaccaccagaagaaatccctcctgtggttgctcctcct
atcccccttttgctaccaacacccgaagaaaagaaaccaccagcaaaacgtattgaagtt
accaaaaaggctgtgaagaaagatgccaaaaaagttgttgcaaagcccaaagaagaggtg
acaccacgtgaagagcttgtcaagaagcctccacctcctactacgttaattccagcaaaa
gctcctgaaatcattgatgtatcctctaaagctgaagaagtaaaaataatgactataacc
agaaagcaagaggttcagaaagaaaaagaagctgtgtatgagaaaaagcaagcagtccac
aaggagaggagagtcttcattgaatctttcgaagaaccttatgacgaactggaggtagaa
ccatacacagagccatttgaacaaccttattatgaagaaccagatgaggactatgaagag
accaaggtagaagctaaaaaggaagttcatgaggaatgggaagaagattttgaagaaggg
caagaatactatgaaagggaagaaggctatgacgaaggggaggaagagtgggaagaggct
taccaagaaagggaagtaattcaagttcaaaaggaggtctatgaagaatcacatgagaga
aaagttccagccaaagtacctgaaaagaaagcaccaccacctcctaaagttataaagaag
ccagtaattgaaaaaattgaaaagacttctcgaagaatggaggaagaaaaagttcaagtc
accaaagtacctgaagtttcaaagaagattgttccacaaaaaccttcccggactccagta
caggaagaagttattgaagtgaaagtaccagctgtgcatacaaagaagatggttatttca
gaagaaaagatgttctttgcttctcacacagaggaggaggtgtcagtcacagtccccgag
gtacaaaaggaaactgttactgaagagaaaattcacgttgctgtttccaaaagggttgaa
ccaccacctaaagtccctgagctgcctaagaaaccagttccagaagaagcggtccctgtt
cccattcctaaaaaagtggagcccccagcaccgaaagttcctgaggttcccaagaaaccc
gtgccagaggagaaaaagccagttcctgtgcctaagaaggaacctgctgctcccccgaaa
gtcccagaggtgccaaagaaacctgtccctgaagaaaagattcctgttcctgttgcaaag
aaaaaggaagctcccccagctaaagttcctgaagtacagaagagagttgtgacagaagaa
aaaataaccattgtaactcaaagagaggaatctccaccaccagcagtaccagaaatacca
aagaagaaagttcctgaagaaagaaaacctgttcctcggaaagaggaagaagttccacca
ccaaaagtgccagctctgcctaagaagcctgtcccagaggagaaagttgcagcgccagtt
cctgtcgctaagaaagctcctcctcgcggagctgaagtctctaagaaaattgttgtagaa
gaaaaaagatttgttgctgaagaaaaactatccttcgcagttcctcaaagagtggaagtc
acgcggcacgaagtatctgcagaggaggaatggagttattcagaagaggaggaaggtgtg
tccatttcagtttatagagaagaagaaagagaggaggaggaagaagcggaggttacagaa
tatgaagtgatggaagagcctgaggaatatgttgtggaagaaaagctgcacattatttct
aagagagtggaagcagagccagctgaagtgacagagaggcaggagaagaaaattgtactg
aaaccaaaaattcctgctaaaatagaggagcctccaccagctaaagttcctgaagcacct
aagaaaattgtgccagaaaagaaagttcctgctccagttcctaaaaaggaaaaggtgccc
ccacctaaagtgccggaagagccaaagaaaccagttccagaaaaaaaggttcctccaaaa
gtcattaagatggaagaacctcccccagccaaagtgccggaggaaccgaagagagctgtc
ccggaagaaaaagttccgaaactcaaacctaaaagagaggaggaaccaccagctaaagtg
actgaattcagaaaaagagtggttaaagaagaagtatcaattgaagctccaaaaagagaa
cctcaacccaccaaagaagtaattataatggaagagaaagaacggtcttatacccgagaa
gaagctgtttcagtacaacgagaagaagaatatgaggaatatgaagaatatgattataaa
gaatttgaggagtatgaaccaacagaagaatatgaccaatatgaagaatatgaggaacag
gagtatgaacgatatgaagagcatgaagaatacatcacagaaccagagaagcctatccct
gtaaagcctgtcccagaagaaccagttcccacaaaaccaaaggccccaccagctaaagtg
ccgaagaaagctgtccctgaagaaaaagtaccagtgcccattcctaagaaactcaaacct
ccaccacccaaagtgcccgaagaaccaaagaaagttgttgaggaaaaaatacgtatttca
attaccaaacgtgaaaaagagcaggtgactgaacccgctgctaaagtgcccacgaagccc
aagagggttgtcgcagaagaaaaagtacctgtccctagaaaagaagtagcaccacctgtt
agagtgccagaaatgcctaaagaacttgaaccagaagaagttgcctttgaagaggaagta
gtaacccatgtagaagaatattttgtagaagaagaagaagagtacattcatgaagaagag
gagttcgtgactgaggaagaagtggtgccagtgataccagtcaaagtgcctgagttaccc
aagaaacctgttccagaagagaagaaacctgttcctgttcccaaaaagaaggaagctcca
ccggcaaaagtgcccgaggttcctaagaagccagaggagaaacttcctgtgcttattcct
aaaaaggagaaggctccgccagcaaaagttcctgaagtgcccaagaaacctgtaccagag
gagaaagtaccagtaccagctcctaaaaaggtggaagctccacctgccaaagtgccagag
gtacccaagaaacctgtgcctgagaagaaggtgccagttcctgttcctaagaaagtggag
gctccacctgcaaaagtgccagaggtgcccaagaagctcatcccagaagaaaagaaacca
acacctgttccgaaaaaagtggaagcaccaccacccaaagtgccaaagaaacgtgaacca
gttcctgtagctctacctcaggaagaggaagttccatttgaagaagaaattgttcctgaa
gaggaagttctacctgaggaagaggaagttctacctgaagaagaggaaattccacctgag
gaagaggaagttcctcccgaagaagagtatgtacctgaggaagaagaatttgtacctgaa
gaagaagtccttccagaagttaaacctaaggtgccagtacctgcagcagtgcctgaagtg
ccaaagaaacctgtaccagagaagaaagtccctgttcccgctcctaaaaaagtggaacct
ccaccaccacccaaagtgcctgagattaagaagaaagtgacagagaagaaagtggtcatt
cccaagaaagaggaggctccccctgccaaagtgcctgtggtacctaagaaacctgagcca
gaaaagaaggtccctcctcctggtcttaagaaagcagtggtgcctcctgccaaagttcct
gaggtgcctaagaaggtggaagaaaaacgaatcattcttcctaaagaagaggaagttcta
ccagttgaagtgactgaggagcctgaagaagagcctattccagaagaggaaatcccagaa
gaaccacctagcatagaggaagttgaagaggtggcaccacctagagtgcctgaagtgatt
aagaaagcagtacctgaagcacctactcctgttcctaaaaaagtggaggcaccaccagct
aaagtgccaaagaaaattcctgaggaaaaagtacctgttcctgttcagaaaaaagaggca
cccccagccaaagtgcctgaagtaccaaagaaagtcccagaaaagaaagtcccagaaaag
aaagtccttgtgcataaaaaagaagctgttcccccagctaaagggagaactgtccttgaa
gaaaaagtatcagttgccttccaccaagaggaagtagtaaaagaaagactagaattagaa
gtagtagaagcagaagtggaagaaattccagaagaagaagagttccatgaagttgaagaa
tattttgaagaagatgagtttcatgaagtagaagaattcgtcaaagtagaagaacataga
gttgaagaagaacacagagttgaagaagtacatagggtaatagaagtttttgaggctgaa
gaagtggaagaatatgaaaaaccaaaagctccacctaaagggcctgagatatctgagaaa
atcatccctccaaaaaaaccacccactaaagttgttcctcgaaaagagccaccagctaaa
gtaccagaggtgcctaagaaaattgtggtagaagaaaaagtacgtgctcctgaagaaccc
aaagttccaccaactaaagcacccgaagtacccaagaaaattgtcccagaagaaaaagtt
cgtgaagctgttcctaaaaagcctgaagttccaccagctaaagttcctggaatgcctaag
aaaagtgttcaagaagaaaaatcacctattgttatttctgaagacacagagatgtacatt
tatgaagcatctgaagaagcagacctagaagaaaaagtacttgtgactcaacctcaaaag
acaaaacccaaactagcaaaagtgcctgagccacccaagaaagttgttccagaggacaaa
atatatgtgactattcctaaaaagagagaaacaccagcaactaaagaacttgatacaacc
aaaggcgtttttccagaggtggaggtacctgaggctattcctgaaattccagaacatcct
ccaactgaagagtttgaagtcttcaaggaagtcattccagaggaagaaactcctactgtt
aaaagaagaaaaacaccatcaccaacagcacctgaagctatgaaagaagttgttcctgaa
atgaaaatgtttgaggatgtacctcaagagccagaaactccacttatgaaaatgcccgaa
gttcctcaagaaattactcctgcaaagagagttccttccaaaaaaagagaacccccatca
gttaaagtgcctgaagctctccaagaaattgtccctgaaaagaaaacgcttgtggttcct
ctcagaaagcccgaagtccttcctgatgaagtgccggaggctctcaaagaagttgtcacg
gaaaagaaagtgcatcctccccaaagggctgaagttgtacctgtcaaagtgcacgaagct
cccaaagagattatcccggaaaagaaagtgttggtggtgcctcctaaaaagcctgaagtc
ccacctgttaaagtgccagaagcttccaaagaggttatccccgaagagaaagtgcccttg
gctcctcttgaagagcctgaagtcccacctgttaaagtgcccaaggctcccaaagaggta
gttcctgaaaagaaagtgccagtggctcctcctaaaaagcctgaagtcccacctgttaaa
gtgcctgaggctcccaaagaagttgttcctgaaaagaaagtgctaatggctcctcctaaa
aagcctgaagtaccacccacaaaagtcccagaggtgccaaaggcagctgtcccagaaaag
aaagtgcctgaagctattcctcccaaaccggaaagtcctcccccagaagtgcctgaagtg
ctgccaccgaaggaagtggtcccagaaaagaaagtaccattgcctcctcccaaaaagcca
gaagctccacctcctaaagttcctgaagctcctaaagaagttgtacttgaaaagaaagta
tctgtggctgtgcccaaaaaaccggaagccccacgagcaaaagtacctgaagctgctcaa
gaagcggtcccagaaaagaaaattcccaaggcaccgatcaaaaaaccagaagccccccca
gttacagtgccagaagttcctcaagaagctgcagagaaagaaattcccgtggctccaccc
aaaaaaccagaagttacaactgtcccagtgcctgaagctcaagaagttgtcccagaaaag
aaagttcccaaagctccgcccaaaaaaccagaagccccacctgccacagtgcctgaagtt
ccacaagaaattgccccagaaaagaaaacactggtacctcctaaaaggccagaagttcca
cctgttacagtgccagaggctcccaaagaagttgtgcctgaaaagaaagtgcccttggtt
cctcctaaaaagcctgaagtcccacctgttaaagagccagaggctcccaaagaagttgtt
gctgaaaagaaagtgccagtgactcctcctaaaaaacctgaagtcccacctgttaaagtg
ccagaggctcccaaagaggttgttcctgaaaagaaagtgcccttggctcctcctaaaaag
cctgaagtcccacctgttaaagtgccagaggctcccaaagaggttgttcctgaaaagaaa
gtgcccttggctcctcctaaaaagcctgaagtcccacctgttaaagttccagaagctccc
aaagaagttgttcctgaaaagaaagtaccagtgactcctcctaaaaagcctgaagtccca
cctgttaaagtgcctgaggctcccaaagaagttattcctgaaaagaaagtgccagtggct
cctcctaaaaagcctgaagtgccacccacaaaagtcccagaggtgccaaaggcagctgtc
ccagaaaggaaggtgcctgaagctattcctcccaaaccggaaagtcctcccccagaagct
ttcgaggagcctgaggaagttgccccagaagagcctcctgctgaagttgtggaagagcca
gagccggctgcgcctccacaagtgaccgtgccacctaagaaacctgtcccagaaaagaaa
gcacgtgctatcgttgccaaaaaacctgaaccaccaccggtgaaagtgcctgaggtgccc
aaggaggttgttcctgaaaagaaggtgcctccagtggttcccaaaaagccagaagcccca
cctgctaaagtgcctgaagttccaaaagaagttgttccagaaaagaaagtagctgttccc
aaaaagccagaagtcccaccagcaaaagtgccagaagtgccaaagaaacctgtcttggaa
gagaaaccagctgttcctgttccggaaagagtggagtctcctcccccagaagtatatgaa
gaacctgaggaaattgctcccgaagaggaagagccagttcctgtcgcagaagaggaggaa
ccaaaagcaccacctccagcagtgcctgaagagcccaagaagatcatcccagagaagaaa
gttcctgtcatcaaaaaaccagaagcaccacctcctaaagaacctgaacctgaaaagaag
gttattgagaaaccaaaactcaaaccaagacccccagctcctccacctgctccacctaag
gaagatgtgagggagaaaatattccaacttaaagctgttccaaagaagaaagttcctgaa
aaacctgaggttccagaaaaagtggagcttacacctctgaaagtgcctggaggtgaaaag
aaagttcgcaaattacttcctgaacgtaaacctgaaccaaaggaagaagttgttctgaaa
agcgttctaagaaaaagacctgaagaagaagagcctaaagtagaacctaaaaaactagaa
aaagttaaaaaacctgcagtaccagaaccaccacctccaaaacctgctgaagaggttgaa
gtacctactgttacaaaaagagaaaggaagattcctgaaccaacaaaagtgcctgaaatc
aagccaccaatacctctccctggacctgaaccgaaaccaaagcctgaagcagaagtgaaa
acaatcaaaccacctcctgtggaacctgaaccaacccccatcgctgccccagtaacagtg
ccggtggttggaaagaaagcagaagccaaagcacctaaggaagaggctgccaagccaaaa
ggtcctatcaaaggtgtagccaaaaagactccttcaccaatagaagccgaaaggagaaaa
ttaaggccaggaagtggtggagagaaacctcctgatgaagccccattcacctaccagcta
aaggctgtgccattgaagtttgtgaaagaaatcacagacatcgtcttgactgaatcagag
ttcgttggctcttcagcaatctttgaatgtttggtatccccctccactgcaattacaacc
tggatgaaagatggtagcaatatccgtgagagccccaagcacaggtttattgcagatggt
aaagacagaaagctgcacatcattgacgttcaactttccgatgctggtgaatacacctgt
gttttacgtttgggaaacaaagaaaagacctccacggctaaacttgttgtcgaagaactt
cctgtgcgttttgtaaaaacactggaagaggaagtcacagtggtcaaaggacagccattg
tacttgagctgcgagttaaacaaagagcgtgatgttgtctggaggaaggatggcaagatt
gtggtggagaaacctggccgaattgtgccgggcgtcattggcttgatgcgggccctgacc
atcaacgatgcagatgacacagatgctggaacatacacagttactgtggaaaacgccaac
aacctggagtgttcatcttgcgtaaaagtagtagaagtcattagagattggctggtgaaa
cctatacgagaccagcatgtgaaacccaaagggacagctatttttgcctgtgatatagca
aaagatactccaaacattaagtggttcaaaggatatgatgaaattcctgcagaaccaaat
gataagactgaaatactgagagatggaaatcatctatacctcaaaattaagaatgctatg
ccagaagatattgacgaatatgcagtggaaattgaaggaaaaagataccctgcaaagctg
acccttggagaacgtgaagttgaactgcttaaaccaatagaggacgttaccatttatgag
aaagaaagtgcaagctttgatgcagaaatctcagaggcagacattcctggacaatggaaa
ctgaaaggagaacttctaaggccctcacctacttgtgaaatcaaagcagaaggtggaaaa
cgcttcttaactttgcacaaagtcaaactggaccaagctggtgaagtcctctaccaggcc
ctgaatgcaattacaactgccattttgacagtaaaagaaatcgaacttgactttgctgtg
cccctgaaggatgtcactgttccagaaaggcgacaggctcgattcgaatgtgtcctcacc
cgagaggcaaatgttatatggtccaaaggacccgatataatcaagtcatctgacaaattc
gatatcattgctgatggaaagaaacatattcttgttattaatgattctcaatttgatgat
gaaggggtctatactgctgaggtagagggcaagaagacctcagctcggttatttgtcaca
ggtataagactgaaattcatgtcgcctcttgaagatcagacagtaaaagaaggtgaaaca
gcaacttttgtatgtgaactttctcatgaaaaaatgcatgtagtctggttcaaaaatgat
gtcaaactccacacaagcagaacagtactcatctcttctgagggcaagactcacaaattg
gaaatgaaagaagtgacactggatgatatatctcagataaaagctcaagtcaaggatctg
agctccacagcacagctgaaggtcttagaggctgatccctacttcactgtgaaattacat
gacaaaactgcagtggagaaggatgagattattttgaagtgtgaagtgagcaaggatgta
ccagtgaaatggttcaaagatggtgaagagattgtcccttcacccaaatattctatcaag
gcagatggcctgcgccgcgttttaaaaatcaaaaaggcagaacttaaagataaaggcgaa
tatgtgtgtgactgtggcacagacaagaccaaggcaaatgttactgttgaggctcgacta
ataaaagtggaaaagcctctgtatggagtagaggtgtttgttggtgaaacagcccgcttt
gaaattgaactttctgaacctgatgttcacggccagtggaagctgaaaggagagcctttg
acagcttcccctgactgtgaaatcattgaggatgggaagaagcatattctgatccttcat
aactgtcagctgggtatgacaggagaggtttccttccaggctgctaatgccaaatctgca
gctaatctgaaagtgaaagaattgcctcttatcttcatcacacctctcagtgatgttaaa
gtcttcgagaaagatgaggctaagtttgagtgtgaagtatccagggaacccaaaacattc
cgttggctaaaaggaacccaggaaatcacaggtgatgacagatttgagcttataaaggat
ggtactaagcattcaatggtgatcaagtcggctgcttttgaagatgaagcaaaatacatg
tttgaagctgaagataagcacacaagtggcaaactgatcattgaaggaatccggcttaaa
tttctcacccctctcaaggatgtaactgccaaagagaaggaaagtgctgtgtttactgtg
gagttatctcatgataacatccgagttaaatggttcaagaatgaccagcgcctacacacc
accaggtcggtctcaatgcaagacgaagggaaaactcattcaatcacattcaaagacctg
tctattgatgatacctctcaaattagagtagaagctatggggatgagttcagaagctaaa
ctcactgtgcttgagggagacccatattttacaggaaaacttcaagattatactggtgta
gagaaagatgaagttattctacagtgtgaaattagcaaagcagatgcaccagtgaaatgg
tttaaggatgggaaggaaataaagccatccaaaaatgctgttattaaggcagatggcaag
aaacgcatgctaatcctaaagaaagccttgaaatcagatattggacagtacacctgtgac
tgtgggacagataagacctcaggaaaacttgacattgaggatcgggaaattaaactggtg
cgacccctgcacagtgtggaggtgatggagactgagacggcccgctttgaaaccgaaatc
tctgaagatgatatccacgccaactggaaactcaagggagaggccctactccaaacacct
gattgtgaaattaaggaagaaggcaaaatacactcccttgttttgcacaactgtcgcctg
gaccagactggtggggtggatttccaagctgccaatgttaaatctagtgcccacctccga
gttaagccgcgagtaattggtcttctgaggcctttaaaggatgtcaccgtgactgcaggg
gaaacagccaccttcgactgcgagctctcctacgaggatatcccggtagaatggtatctc
aaagggaagaaactagagcccagcgataaggtggtcacacgttcagaaggaaaagttcat
acacttactctgagggatgtaaagttagaagatgctggggaagtccaactaacagcaaaa
gatttcaaaactcacgccaacctctttgtgaaagaacccccagttgaattcactaagcct
cttgaggaccagacggtcgaagagggagccactgcagtgctggagtgtgaagtctccaga
gaaaatgctaaggtgaaatggttcaaaaatgggacagaaatcctcaaaagcaagaagtat
gaaattgttgctgatggcagggtcagaaaacttattatacacggctgtaccccagaggat
attaaaacatacacttgtgatgctaaggattttaagacttcctgtaacctgaatgttgtg
cctcctcatgtggaattcttaagaccactcacagaccttcaagttagagaaaaagaaatg
gctcgatttgagtgtgaactttcccgagaaaacgctaaggttcagtggtttaaagatggt
gctgaaattaaaaagggcaaaaaatatgacatcatatccaagggagcagtgcgcattctt
gtcatcaacaaatgtctactggatgacgaagctgaatattcctgtgaagtaaggacagcg
agaacttctggcatgctgacagttctggaagaagaagctgtctttaccaaaaatcttgcc
aacattgaagttagtgaaacagacactataaaactggtttgtgaagtctccaaacctggc
gcagaagtgatttggtataaaggggatgaggagatcattgaaacaggaagatatgaaata
ctgactgaaggacggaagagaatcctggtcattcagaacgctcaccttgaggatgccggc
aactacaactgtcgactcccaagctctcgaactgatggcaaagtcaaagtacatgaactg
gctgctgaatttatctcaaagcctcaaaaccttgaaatacttgaaggagaaaaggctgaa
tttgtgtgctctatatcaaaagaaagctttccagtccagtggaagagggatgataagata
cttgaatctggagataaatatgacgttattgctgatggtaaaaagagggtcctagctgtg
aaagatgccacattacaagatatgggcacttacgtcgtcatggtaggggctgccagagca
gcagctcacttaacagtcattgaaaaactcaggatcgtagttcctcttaaggacacccgg
gtgaaggaacaacaagaagttgtcttcaactgtgaagtcaacactgaaggtgccaaagcc
aaatggttcagaaatgaagaagccatatttgatagttcaaaatacattattctccaaaaa
gacctggtctacaccctcagaattagagatgcacgcttagacgaccaagccaactataat
gtgtctttgaccaatcacagaggtgaaaatgttaaaagtgcagccaatctaatagtagaa
gaggaagaccttaggattattgagcctcttaaagatattgaaacaatggagaagaaatct
gtcacattctggtgcaaggtgaatcgtctcaatgtaacactgaagtggaccaaaaatggt
gaagaagtgccttttgacaaccgtgtctcatacagaattgataagtacaagcactcgtta
actattaaagactgtggcttcccagatgaaggtgaatacattgtcactgctggacaagac
aaatctgttgctgaacttctcatcatagaagcccctacagaatttgtggaacacttggaa
gatcagacagtcactgagtttgatgacgctgtcttctcctgccagctctccagagagaaa
gccaatgtaaaatggtacagaaatgggagagaaatcaaagaaggcaaaaaatacaaattt
gaaaaagatggaagtatacacagactcattataaaagattgcaggctggatgatgagtgt
gaatatgcttgtggagtagaagacaggaagtctcgtgctagactttttgtggaagaaatt
cccgttgagatcatcaggcctccacaagatattcttgaagcccctggtgctgatgttgtc
tttttagcagaactcaataaagataaggtggaagtccaatggctaagaaataacatggtt
gttgtccagggtgataaacaccagatgatgagtgaaggaaagatacatcgactacagatt
tgtgatattaagccccgtgaccagggtgaatacagatttattgccagagacaaagaagcc
agagctaagcttgaactggcagctgcaccgaaaatcaagacaggtgaccaagaccttgtg
gttgatgttggccagtctctgacaatggtggtgccgtatgatgcctaccccaaagcagaa
gctgaatggtttaaagaaaatgaacctttatctacaaaaaccattgatactacggctgaa
aaaacttctttcagaattttagaagccaagaaaggagacaaagggagatataaaattgtg
cttcagaacaaacatggaaaagcagaaggattcatcaatttaaaagttattgatgttcct
gggccagtacgtaacttagaagtgacagaaacatttgatggtgaagtgagccttgcttgg
gaagaacctttaactgatggtggaagcaaaatcataggttatgttgttgaaagacgtgac
attaagagaaagacctgggttctggccacagaccgtgcagacagttgtgagtttactgtc
actggtctacagaaaggaggagttgagtatctattccgtgtaagtgcaagaaatagagtt
ggcactggtgaaccagtagaaactgacaatcctgtagaagcaaggagtaaatatgatgtt
ccaggccctcctttgaatgtaaccatcactgatgtgaatcgatttggtgtctcactgaca
tgggaaccaccagagtatgatggaggtgctgagatcacaaactacgtcattgaattaaga
gacaagacttctatcaggtgggatactgccatgactgtgagagctgaaaacctgtctgca
actgttactgatgtggtagaaggacaggagtacagtttccgagtgagagcccaaaatcga
attggagtcggaaaaccaagtgcagccacacccttcgtcaaagttgccgatccaattgag
agaccaagtcctcctgtaaacctaacttcctcagatcagactcagtcatcagttcagctc
aaatgggaacctcctctgaaagatggaggaagcccagtattaggctatataattgagcga
tgtgaagaaggaaaagataattggattcgttgcaataagaaacttgtccctgaactgact
tacaaggttaccggattggaaaaaggaaataaatatttatatagagtatcggcagaaaat
aaagctggtgtttcagatccgtctgaaattcttggtcctctcaccgctgatgatgcattt
gttgaaccaacaatggatttaagtgcatttaaagatggtctggaagttattgtcccaaat
cctatcaagatcctggttccaagtacaggctatccaaggccaactgcaacctggtgtttt
ggagataaagtactagaaacaggggaccgtgtgaaaatgaagaccttgtctgcctatgcc
gaacttgtcatttctccaagtgaacgttcagacaagggcatttatacactgaaattagaa
aaccgtgtgaaaacaatttctggggaaattgatgtcaatgtaattgctcgcccaagtgca
cccaaagaactgaaatttggtgatataaccaaggactcagtacatttgacttgggaacca
cctgatgatgatggaggaagtccgttaactggatacgttgttgaaaaacgagaagtcagc
cggaaaacatggactaaagttatggactttgtaactgatctagaattcacagttcctgat
cttgttcaaggaaaagagtatttatttaaagtttgtgctcgtaataaatgtggccctgga
gaacctgcatatgttgatgaacctgtaaatatgtcagctcctgcaacggtacctgaccca
ccagagaatgttaaatggagagatcgaacagccaatagcatcttcttaacatgggatcca
cctaaaaatgatggtggttcacgcatcaaaggatatatagttgaaagatgtccacgtggt
tctgataaatgggttgcctgtggagaacctgttgcagaaacaaagatggaagtgacaggt
cttgaggaaggcaaatggtatgcctaccgcgtgaaggccttaaacaggcagggcgctagc
aaaccaagcagacccacagaggagatccaggctgtggacacacaagaggccccagaaata
ttcctcgatgtgaagctccttgctggtctcaccgtaaaagctgggaccaagattgaactt
cctgccactgtaaccggaaaacctgaacctaaaataacttggacaaaggctgatatgatt
ctgaagcaggacaaaagaattaccattgaaaatgtccctaagaaatccacagtgactatt
gttgatagtaaaagaagtgacactggcacatacatcatcgaggctgtgaacgtgtgtggc
cgggctactgctgtggtggaagtgaacgtcttagataaacctggaccaccagctgccttt
gacatcacagatgtaaccaatgagtcatgtcttctaacatggaacccaccacgcgatgat
ggtggatctaagatcacaaactatgttgtggagagacgagcaactgatagtgaagtgtgg
cacaagctctcatccaccgtcaaggatacaaacttcaaggccaccaaattaatccccaat
aaagagtacatcttcagagttgctgcagaaaacatgtatggtgttggtgaaccagttcag
gcctctccaataacagccaagtatcagtttgatccacctggacctccaactcgcctagaa
ccttctgatatcactaaagatgcagtgactctcacgtggtgtgagccagatgatgatggt
ggcagcccaatcactggatactgggttgaaagactggatcctgacacggataaatgggtt
agatgcaataagatgccagtaaaggacacaacatacagagtgaaaggtctcaccaataag
aaaaaatacagattccgtgtgttggctgaaaatcttgctggacctggaaaaccaagcaaa
tcaactgaaccaatcttaataaaggatcccatagatcctccatggccccctggaaaacca
actgtaaaagacgtaggcaaaacatcattaaggttgaattggacaaaaccagaacacgat
ggaggcgcaaagattgagtcttatatcattgaaatgctgaagactgggacagatgagtgg
gtcagagtggcagaaggggttcccaccactcagcacttgctcccagggctcatggaagga
caggaatactcattccgagttagagctgtgaataaggctggggaaagtgaacccagtgaa
cccagcgaccctgtgctttgccgggagaagctatatcctccatcaccaccacgctggctt
gaagttattaatatcacaaaaaatacagcagacctaaaatggacagttcctgagaaagat
ggagggtcccccatcaccaactacattgtggaaaagagagacgtcaggcgaaaaggctgg
caaacagtggataccaccgtcaaggacaccaagtgcacagtcaccccgctgaccgagggc
tctttatatgtgttccgagttgctgcagaaaatgctataggacaaagtgactacaccgaa
attgaggactctgtgctggccaaagacacctttacaactcctggaccaccctatgccctg
gcagtggttgatgtgacaaaacgacatgttgacctaaagtgggagccacctaaaaatgat
ggtggaagaccaattcagagatatatcattgagaagaaagaaaggttaggtacccgttgg
gtgaaagcaggaaagactgcaggacctgactgtaacttcagagtaactgatgtcattgaa
ggaacagaggtccagtttcaggttcgggctgaaaatgaagctggagttggccacccaagt
gaacccacagaaatcctatccattgaagatccaacaagtcctccctcaccaccccttgac
ctacatgtgactgatgctgggagaaaacacattgccattgcttggaagcctccagagaaa
aatggtggaagtcctatcataggataccatgttgaaatgtgtccagtaggcactgagaaa
tggatgcgagttaattctcgcccaataaaggacttgaaattcaaggttgaagaaggtgtt
gttcctgacaaagaatatgtcctgagagtgagagcagtcaatgctattggtgtcagcgag
ccatctgaaatctctgaaaatgtggttgccaaagacccagactgcaagccaacaattgac
ctggagactcatgacattattgttattgaaggtgaaaagttaagcattcctgttcccttc
agagctgtcccagttccaactgttagttggcataaagatggcaaagaagttaaagcaagt
gatagattaacaatgaagaacgatcacatctcagcccaccttgaagttcccaagagtgtc
catgcagatgccggagtttataccattacactggagaataagctcggctcagcaacagcc
tcaatcaatgtcaaagtcataggcctacctggaccatgcaaagatatcaaagcaagtgac
attaccaagagttcttgtaagttaacctgggaacctccagaatttgatggtggaacccca
attcttcattacgtcctggagcgcagagaagctgggagaagaacatatataccagtcatg
tctggtgagaataaactgtcgtggactgtgaaggatctcataccaaatggtgaatatttc
ttccgtgttaaagcagtcaacaagattggtggaggagaatatattgaactgaaaaatcca
gtcattgcccaagatccaaagcaaccccctgatccacctgtagatgtagaggttcataat
cctacagcagaggcaatgactattacatggaagccacctttgtatgacggaggaagcaag
ataatgggctacatcatagagaagattgctaagggtgaagaaaggtggaagagatgcaat
gaacacctggtaccaatcctgacctatacagcaaaaggacttgaagaggggaaagagtac
caattccgtgtgcgagcagagaacgccgcgggtattagtgaaccttctcgggctactcct
ccaacaaaagctgtagatcccattgatgcccccaaagtcattctgagaacaagcctagaa
gtgaaacgaggtgatgaaatagcacttgatgcaagtatttctggatcaccttacccaact
attacatggataaaggatgagaatgctattgtaccagaggaaattaagaagcgtgcagca
cccttgcttagaagaaggaagggtgaagttcaagaagaagaaccatttgtcctgcctctg
acacagcgtttgagtattgacaacagcaaaaagggagaatctcagctacgcgtccgagat
tctctccgacctgaccatggtctgtatatgatcaaagttgaaaatgaccacggtattgca
aaagctccttgtactgtcagtgtgttagatacaccaggaccaccaatcaactttgtattt
gaagatatcagaaagacctcagtcctttgtaaatgggaaccaccccttgatgatggtggc
agtgaaatcataaactacactttggaaaagaaagacaagacaaaacctgactcagaatgg
attgttgtcacttcaacacttagacagtgcaaatattcagtaacaaaactgattgaagga
aaagagtacctcttccgtgtaagagctgaaaatagatttgggccaggtccaccatgtgtt
tcaaagccacttgtagctaaagatccatttgaaccacctgatgcaccagataagcccatt
gtggaagatgttaccagcaacagtatgctagtgaaatggaatgaaccaaaagataacgga
agccccattttgggttactggcttgaaaaacgtgaggttaatagtacacattggtctcgt
gtcaacaaaagccttctgaatgccttgaaagccaatgtagatggcttattagaaggactc
acctatgtcttcagagtatgtgctgaaaatgcagctggacctggaaagttcagtccacct
tcagatcccaaaacagcacatgatccaatctctccacctgggccacctattccaagagtc
actgacacaagctctacgactattgaactagaatgggaacccccagctttcaatggcggt
ggggaaattattggctattttgttgataagcagttggttggcacaaatgaatggtcacgc
tgcacagagaagatgatcaaggtccgtcagtacacagtcaaagaaatccgagagggtgct
gattataaacttcgggtgagtgccgtcaatgtcgcaggggaaggaccgcctggagaaaca
gaacctgttactgtggctgaaccacaagagcctccaactgtggaactggatgtttctgtc
aagggtggaatacaaataatggctgggaagactcttagaattccagctgtggtaacgggt
cgccctgtacctacaaaagtatggaccaaagaagaaggggagctggataaagaccgcgtt
gtaatagacaatgttggaaccaaatctgaactaattatcaaggatgcactgcgaaaagac
catggcagatatgtgattacagctacaaatagctgtggttccaaatttgcagcagccagg
gtagaagtttttgatgtccctggtccagttcttgatttaaaacctgttgtaacaaacaga
aaaatgtgtctacttaactggtctgatccagaagatgatggaggaagtgaaataacaggc
ttcatcattgaaagaaaagatgccaagatgcatacttggagacaaccaatagagactgag
aggtctaaatgtgacatcacaggtctgcttgagggacaagaatataagttccgtgttatt
gccaagaacaagtttggctgtggccctcctgttgaaataggaccaattcttgcagttgat
ccactaggtcctccaacatctccagagaggctgacatacactgaaaggacaaagtccact
atcacccttgactggaaagagccccgcagtaatggtggcagtcccatccaaggatatatc
attgaaaaacggcgtcacgacaaacctgactttgaaagagttaacaagcgactctgccca
accacatcttttctggttgaaaatcttgatgaacaccaaatgtatgagttccgtgtcaaa
gctgtcaatgaaattggtgaaagtgaaccatccctgcctcttaatgtagtcatacaagat
gatgaagtgcctccaactattaagttgcgtctgagtgttcgaggagacactatcaaagtt
aaggcaggagagcctgtccacatccctgcagatgtaacaggccttccaatgcctaagatt
gaatggtccaaaaatgaaaccgtaattgaaaaacccactgaggcacttcagataaccaag
gaagaggtatcccgaagtgaggcaaaaactgagcttagcattcccaaagcggtccgggaa
gacaaaggcacttacacagttactgcttccaatcgccttggctcagtgttccgaaatgtt
cacgttgaagtatatgaccgcccatccccaccaagaaaccttgctgttactgacattaaa
gctgaatcttgctacttgacatgggatgcccctcttgataatggtggcagtgaaatcacc
cattatgttattgacaaacgtgatgcaagtaggaagaaaacagaatgggaggaagtcacc
aacactgctgtagagaaaagatatgggatttggaaacttatccccaatggccagtatgag
ttccgagtcagggcagtgaataaatatggaatcagtgatgagtgcaaatcagataaagta
gtcattcaagatccttatcgccttcctggacctccaggaaaaccaaaagttttggcacgc
accaaaggatcaatgctagtgagctggactcctcctttggacaatggtggctctccaatt
actggctactggctggagaaaagagaagagggaagtccttactggtcacgtgttagccga
gcaccagtaaccaaagtgggattgaaaggcgtggaatttaatgttcctcgtttgattgaa
ggcgttaaataccagttcagagccatggcaataaatgctgcaggaattggtcctcccagt
gaaccatcagatccagaggttgcaggagatcccatatttccaccagggccaccttcttgc
ccagaagtaaaagataaaacgaagtcaagcatctcactaggatggaaacctccagccaaa
gacggtggcagcccaatcaaaggatacattgtagaaatgcaagaagaaggtactactgac
tggaaaagagtaaatgaaccagacaaacttataactacctgtgaatgtgtggtgcctaat
ctgaaagagctcaggaagtacagattcagagtgaaagctgtcaatgaagctggtgaatct
gaaccaagtgatacaaccggagagatccctgccactgatattcaagaggaaccagaagtt
ttcattgacattggagcacaggactgtctggtttgtaaagctggctcacagattaggatt
cctgctgtcatcaagggacgcccaacaccaaaatcatcttgggaatttgatggaaaggca
aagaaagcaatgaaggatggagttcatgacatacccgaagattcacagctcgagactgct
gaaaactcctcagtaattattattccggagtgtaaacgatctcatacaggcaaatacagc
atcacagccaagaataaagcaggacaaaagactgcaaattgcagagttaaagtcatggat
gtaccaggcccacccaaagatctgaaagtcagtgatatcacaaggggtagttgcagactt
tcatggaagatgccagatgatgatggaggagacaggattaaaggctatgttatcgagaag
agaactattgatggaaaagcctggaccaaagtcaatccagactgtgggagcacctcattt
gtagtgcctgatctcctctctgaacagcaatatttcttccgtgtgcgagcagaaaaccgt
tttggtattggcccacccgtggaaaccattcagaggaccactgccagagatccaatatat
cctcctgatcctcctattaaactcaaaattggcctcatcacaaagaacacagtgcatctg
tcatggaaacccccaaagaatgatgggggctcccctgttacccactatattgttgagtgc
cttgcatgggaccctactgggacaaagaaagaagcctggaggcagtgcaataagcgtgat
gtggaagaactgcaatttactgttgaagacctagtagagggtgggcaatatgaattccga
gttaaagctgtcaatgctgcaggagtcagcaagccttcagccactgttggccccgtgact
gtcaaagaccagacatgcccaccatcaattgagctaacagaattcatggaggttgaagaa
ggaactgatgttaacattgtggccaaaattaaaggtgtgccattcccaacactaacctgg
tttaaagctcctccaaagaagcctgataacaaagaacctgttctctatgacacccatgtc
aacaaactggtggtggatgatacttgcactttagttattccacagtctcgcaggagtgac
actggcttatataccatcacagctgtaaataatctgggaacagcatcaaaggagatgaga
ctgaatgtcctgggtcgtcctggccccccagtgggacccataaaatttgaatctgtttca
gcagagcaaatgacactgtcttggcttccacctaaagatgatggtgggtctaagattaca
aactatgtaattgagaaaagagaagctaacaggaagacatgggtccgtgtctccagtgaa
cctaaagagtgcacatacacgattcccaaattgctagaaggccatgaatacgtatttcga
atcatggcccagaataaatatggcattggagaacctcttgacagtgaacctgaaacagca
agaaacctcttctctgtccctggagcaccagataaaccaacagttagcagcgtgactcgt
aactccatgaccgtcaactgggaagagccagaatatgatggaggctctcccgtgacaggg
tactggctggaaatgaaagacactacttcaaagagatggaagagagttaaccgagatcct
atcaaagccatgactctgggtgtttcttataaagtgactggtcttattgaaggttctgac
tatcaattccgggtatatgcaatcaatgctgctggcgtgggtccagcaagtctgccatca
gacccagtgactgctagagatccaattgctcctcctggtcctccatttcccaaagtgaca
gattggactaaatcatctgcagatctggagtggtctcccccactaaaagatggtggatcc
aaagtaactggatacatcgttgaatataaagaagaaggaaaagaagaatgggaaaggggt
aaagataaagaagtgagaggaacaaagcttgttgtgaccggattaaaggaaggagcattc
tacaaatttagagttagagcagtcaacattgctggcattggagaacctggagaggtcaca
gatgtcattgaaatgaaagacagacttgttttacctgaccttcagctagatgccagtgtc
agagatagaattgtcgtgcatgctggaggagtgatccgaatcattgcctatgtgtctgga
aagcctcctccaaccgtcacctggaacatgaatgaaagagccttacctcaagaagccacc
attgagaccacagctattagctcatccatggtcatcaagaactgccagaggagccatcaa
ggcgtctattctcttcttgccaaaaatgaagccggagaaagaaagaagacaattattgtt
gatgtattagatgttccgggtcctgttggaacaccattcctagctcacaacctaaccaat
gagtcctgcaaactgacatggttttctccagaagatgatggaggctctccaatcaccaat
tacgtcattgaaaagcgtgaatctgaccgcagagcatggaccccagtgacatatacagtt
acccgacaaaatgctactgtccagggtctcattcaaggaaaagcctactttttccgaatc
gcggctgaaaatagtattggcatgggtccatttgttgagacatcagaggcacttgttatc
agagagccaataactgtaccagaacgtcctgaagacctggaagtcaaagaagttactaaa
agtactgtaactttgacttggaatcctcctaagtatgatggcgggtcagaaattattaac
tatgtcctagaaagtcggctcattggaactgagaagttccacaaagttacaaatgacaac
ttgcttagcagaaaatacactgttaaagacttaaaagaaggtgatacctatgagtaccgt
gtcagtgctgtcaacattgttggacaaggcaaaccatcattttgcaccaagccaatcact
tgcaaggatgagctggcacccccaacacttcacctcgacttcagagataagctcacgatt
cgagttggtgaagcttttgccctcactggccgttactcaggcaaaccaaagcctaaggtt
tcctggttcaaagatgaagctgatgtgctggaagatgatcgcactcacataaagaccaca
ccaacaacacttgctttagagaagatcaaggccaaacgttcagattccggcaaatactgt
gtggttgtggagaatagtacaggctctaggaaaggtttctgtcaagttaatgttgttgac
cgtccaggtccaccagtaggaccagttatttttgatgaggtgaccaaagattacatggtt
atctcttggaagcctcctttagatgatggaggcagtgaaattaccaattatattattgag
aagaaggaactgggtaaagatgtctggatgccagtgacatctgcaagtgctaaaacaaca
tgcaaagtttctaaactacttgaaggaaaagattatattttccggatacatgctgaaaat
ctgtatggaataagtgatcctctggtgtctgattcaatgaaagccaaagatcgtttcagg
gttcctgatgcacctgatcagccaattgttacagaagttaccaaagactctgcattagta
acctggaacaagccacatgatggaggaaaacctatcacaaactacatcctggaaaagaga
gaaactatgtctaaacgatgggctagagttaccaaagatcctattcatccgtacactaaa
tttagggttcctgatcttctagaaggatgtcagtatgaattccgggtttctgcagaaaat
gaaattggtattggagatccaagcccaccatccaaaccagtctttgctaaagatccaatt
gctaaaccaagtccacctgttaatcctgaagcaatagatacaacatgcaattcagtcgat
ctaacttggcagccaccacgtcatgatggtgggagcaagattctgggttatattgttgag
taccagaaagttggagatgaagagtggagaagagccaatcatacccctgagtcatgtcct
gaaactaaatataaagtcaccggtcttcgggacggtcaaacttataagttcagagtgtta
gcagtcaatgaagctggtgaatcagatccagctcatgttccagagccagtcctagtaaaa
gacagacttgaaccccctgagttgattcttgatgccaacatggcaagagaacaacacatt
aaggttggtgatactctaagacttagtgccatcatcaaaggagtgccattcccaaaagta
acttggaaaaaagaagacagagatgctccaactaaagcaagaattgatgtgactccagtt
ggtagcaagcttgaaattcgtaatgctgcccatgaagatggtggaatttattctttaaca
gtggagaatccagctggttcaaaaactgtgtcagtaaaagtacttgtattagataaacct
gggccacctagagatctggaagtcagtgaaattaggaaagattcttgttaccttacttgg
aaagaaccactggatgatggtggttctgttattaccaattacgtggttgagaggagagat
gttgccagcgcccagtggtcatctctctcagctacatcaaagaaaaagagtcacttggct
aaacatctgaatgaaggcaaccagtacctcttccgagtagctgcagagaaccagtatgga
cgtggtccttttgttgaaacaccaaaaccaatcaaggctctggatcctctccatccccca
gggccacccaagaacctgcaccatgtagatgttgacaagactgaagtctccctcgtctgg
aataagccagatcgtgatggtggttctccaatcactggatatttggtggaatatcaagaa
gaaggcacccaggactggattaaatttaagactgtgacaaacttagattgtgtggttact
ggactacaacaaggaaagacctatagattccgtgtaaaagctgaaaatattgtgggtctt
ggtctccccgacacaactatcccgatagaatgtcaagaaaaactagtgcctccgtccgtg
gagctagatgtgaaattaattgaaggtcttgtggtaaaggctggaaccacagtcagattc
cctgctattataagaggtgtgcctgttcctaccgcaaagtggacaaccgatgggagtgag
attaaaaccgatgagcactacacagttgaaacagacaacttctcatcagtacttaccatt
aagaactgcttaaggagagacactggagaatatcaaatcacagtttccaatgcagctggt
agcaaaacagtagccgtacatcttactgttcttgatgttcctgggccaccaacaggtcct
attcatattctggatgttactcctgaacacatgactatctcatggcagccacctaaggat
gatggaggaagccctgtgataaattatattgttgagaaacaagatacaaggaaagacact
tggggtgttgtctcttcgggaagcagtaagacaaagctgaaaatcccacatctgcagaag
ggctgtgaatatgttttccgagttaaagcagagaataagataggtgttggtcctcccctt
gactccacacctactgttgctaagcataaatttagtcctccatctcctcctggtaaacca
gtggttactgacattactgaaaatgcggcaacagtgtcttggaccctgccaaaatctgat
ggtggcagtccaataactggctactatgtggaacgtcgagaagtaactggcaaatgggtg
agggtcaacaaaacacctattgctgaccttaagttcagagtgactggactctatgaagga
aatacatatgagtttagggtttttgctgaaaatcttgcaggactaagcaatccatcccca
agttccgatccaataaaagcttgccgtcccatcaaaccacctggaccacctattaatcct
aaactgaaagacaagagcagagaaacagctgatttggtgtggacaaagcctctcagtgat
ggtggtagccccattctaggatatgtagtggaatgtcagaaacctggcacagcacaatgg
aacaggattaataaagatgaactcattaggcaatgtgcctttagagtacctggactaatt
gaaggaaatgagtacagattccgtataaaggcagctaatattgtaggagagggtgagcca
agagaactagcagaatctgtgattgcaaaagatatccttcatcctccagaagtagaactt
gatgttacttgtcgtgatgttattaccgtgagagtaggccaaactatccgcattctagct
cgagtcaaaggcagacctgcaccagacataacttggactaaggaaggcaaagtattggtc
cgagaaaagagggtggacattattcaggatctacctcgtgttgagttacaaattaaagaa
gctgttagagctgatcatggcaagtatatcatctcagctaagaacagcagtggacatgcc
caaggttcagccattgttaacgtccttgacagacctgggccttgccagaatttgaaggtt
accaatgtaaccaaagagaactgtacaatttcttgggaaaacccactagataatggcggc
tcagaaataacaaacttcatagtagaatatcgcaaaccaaaccagaaaggctggtcaatt
gttgcatcagatgtcactaaacgattaatcaaggccaaccttttagccaacaatgaatac
tatttccgagtttgtgcagagaataaagtaggtgttgggccaaccatcgaaacaaaaact
cccattctggctattaaccctattgacagaccaggtgagcctgaaaaccttcacattgca
gataaaggaaagacatttgtctacctaaagtggcggaggcctgattatgatggtggcagt
ccaaatctctcatatcatgttgagagaaggctgaagggctccgatgactgggaaagagtg
cataaaggaagcattaaagaaactcactacatggttgacagatgtgttgaaaaccagatt
tatgagttcagagtgcaaacgaagaatgaaggtggggaaagtgactgggtgaagacagag
gaagttgttgttaaagaagacttacaaaaaccagtacttgatctgaaattaagtggggtc
ctaactgtcaaagcaggggacaccattaggcttgaggcaggggttagaggcaaaccattc
ccagaagtttcatggaccaaggacaaagatgctacagactttacaagatcaccaagggtc
aagattgataccagtgctgattcatctaaattttctcttactaaagcaaagcgaagtgat
gggggtaaatatgtagttacagcaactaacacagctggcagttttgtggcctatgccact
gtcaatgttttagataagcctggtcctgtgagaaatctgaaaattgctgatgtgtccagt
gataggtgtactgttcgctgggatccaccagaagatgatggcggctgtgaaatccaaaat
tatattctagaaaaatgtgagacaaagcgaatggtttggtctacctattctgctactgtc
ttgacacctggtactacagtaacacgtctcatagaaggaaatgaatatattttcagagtc
cgtgcagaaaataaaataggcacagggcctccaacagaaagtaaaccagtcatagccaaa
accaagtataataaacctggacgccctgatcccccagaagtcactaaagtaagcaaagaa
gagatgactgtggtttggaatccacctgaatatgatggtggaaagtctataacaggatac
tttttggagaaaaaggaaaagcattcaacacgatgggtccctgttaacaagagtgcaatc
cctgagagacgtatgaaagtacagaatctcctcccagaccatgaatatcagttccgtgtc
aaggcagaaaatgaaattggaattggagaaccaagcttgccttcaagaccagtggtggca
aaagaccccatagagccacctggtccaccaaccaatttcagagtggttgatacaaccaaa
cattccataactcttgcgtggggaaaaccagtctatgatggcggtgcaccgatcattgga
tatgttgtggaaatgagaccaaaaatagcagatgcatctcctgatgaaggctggaaacgg
tgtaatgctgcagcacagcttgtacgcaaggaattcactgttactagcttggatgaaaac
caggaatatgagttcagggtgtgtgcccaaaaccaagttggtattgggcgccctgcagag
ctaaaggaagctatcaaacctaaagaaatactagaacctccggagattgatttggatgcc
agcatgagaaaactggtcacagtgagagcaggatgccctattcgtctctttgctatagtg
agaggacgaccagcccctaaagtcacttggcgaaaagtgggcattgataatgtggtcaga
aaaggacaagttgatctggttgacactatggccttccttgtcatccccaattctacccgt
gatgactcaggaaaatattccttaacacttgtgaacccagcaggagaaaaggctgtattc
gtaaatgtcagagtattagacactcctggacctgtgtctgatttgaaagtttcagatgtc
actaaaacatcatgccatgtgtcctgggcccctcctgaaaacgacggtgggagccaagtg
acacattatattgtggagaaacgtgaggcagacagaaagacatggtcgaccgttacccca
gaggttaagaaaacaagcttccaagtaaccaatcttgtccctgggaatgagtattacttc
agagtaactgctgtcaacgaatatggccctggcgtcccaacagatgtcccaaaaccagtg
cttgcatcagatcctctaagtgagccggatcccccaaggaaattagaagtgactgaaatg
acaaagaacagtgccaccttagcctggttacctcccctgcgtgatggaggtgctaaaatc
gatggctacatcattagttacagagaagaagagcagcctgcagatcgctggacagagtac
tcagtggtgaaagatctcagccttgttgtcactggcctaaaggaaggaaagaaatacaaa
tttagagtagcggccagaaatgctgttggagtcagtttgccaagagaagctgaaggagtg
tatgaagccaaagaacaactgttgccaccaaagatccttatgccagagcaaattactatc
aaagctgggaaaaaactccgaattgaagcccacgtgtatggaaagcctcatcccacctgt
aaatggaaaaaaggagaagatgaagttgtcacatccagccacctggcagtgcataaagca
gacagctcttcaattctgatcataaaagatgtgactagaaaagacagtggttactacagc
ctcacagcagagaacagttctgggacagacactcagaaaatcaaagttgtagtcatggat
gcccctggcccccctcagcctccatttgacatttctgatatagacgccgatgcttgctcc
ctgtcgtggcacatccctctggaggacggaggcagtaacatcaccaattacatagtggaa
aagtgtgatgtaagccgaggggactgggtcacggctctagcttcagtcacaaaaacttcc
tgcagggttggaaagctgatcccaggccaggagtacatcttccgggtccgtgctgaaaac
cgatttggcatctcagagcctctcacatctccaaagatggttgcggagttcccatttggt
gttcctagtgaaccaaagaatgcacgagtcaccaaagtcaacaaggactgtatttttgtt
gcatgggacagaccagacagtgatggagggagccccattactggttatctgattgaacgc
aaggaaagaaacagtttgctgtgggtgaaagccaatgatgctcctgtccggtcaactgaa
tatccttgtgctggccttgtagaaggtcttgagtattcattcagaatctatgccttaaac
aaagctggatccagcccacccagcaaacccacagaatatgtaactgcaagaatgccagtt
gatcctcctgggaaacctgaagttattgatgtcaccaagagtactgtatctctgatctgg
gcacgtccaaagcatgatggaggcagtaaaattattggttatttcgtagaagcttgcaaa
cttcctggtgataaatgggtacggtgcaatactgcacctcaccagattccccaggaagag
tacacagctactggcctagaagagaaagctcagtatcaatttagagctattgccaggacc
gcagtaaacattagcccaccttcggaaccttctgatccagtgactatcctcgcagaaaat
gtccctcccaggatagacctaagtgtggctatgaaatcattgcttactgtgaaagctgga
actaatgtctgcttggatgctactgtttttggtaaaccaatgccaacggtttcttggaag
aaagatggaacactgctaaaaccagcagaaggcataaagatggcaatgcagcggaatctg
tgcaccttggagctattcagcgtgaaccggaaggactcgggagactataccattaccgct
gaaaattcaagtggttctaagtcagccaccattaagcttaaggtgttagataaaccgggt
cctccagcatctgttaaaatcaacaaaatgtattcagatcgtgcaatgctttcttgggaa
ccgcctcttgaagatggaggctcagaaatcaccaactatattgttgacaaacgtgaaaca
agcaggcccaactgggctcaagtctctgcaactgtgcctatcaccagctgcagcgtggag
aaacttatagagggccatgagtatcagttccgtatttgtgctgaaaataaatatggagta
ggcgatccagtcttcactgaaccagcaattgccaaaaacccatacgacccaccaggacgc
tgtgatcctcctgttattagcaacataaccaaagatcacatgacagtcagctggaagcca
ccagcagatgatggcggctcacccatcaccggctatttgcttgaaaagcgggaaacccag
gctgttaactggactaaggtcaacagaaaacctattatagaaagaacattaaaagcaaca
ggtcttcaagaaggtaccgaatatgagttccgtgttacagctataaataaagctggacca
ggcaaacccagtgacgcatccaaggccgcttatgctcgggaccctcagtatcctcctggc
ccaccggctttccctaaagtatatgatacaactcgtagctccgtgagtctatcctggggc
aagccagcctatgacggcggcagccctatcattggttatctcgttgaagtaaaacgggct
gactccgataactgggtgaggtgcaacttaccacagaatctacagaaaacccgctttgag
gttactggcctgatggaagacacacagtatcaatttcgtgtgtacgccgtgaataagatt
ggatacagtgaccccagtgatgtgccagataaacactatcccaaggacatcttaattcca
cctgagggagaacttgatgcggatttaaggaagacactcatattacgtgctggagttact
atgagactatatgtaccagtaaaaggacgcccacctccaaagattacttggtctaaacct
aatgtcaatctaagagacaggattggactggacataaagtcaactgactttgacactttc
ttgcgctgtgaaaatgtgaacaaatatgatgcaggaaaatacatcttaaccctggagaac
agctgtggtaaaaaggaatataccattgttgtgaaagtgcttgatactcctgggccacct
gtcaatgtgactgttaaggaaatagccaaagactctgcttatgttacctgggagcctccc
attattgatggtggaagccccatcataaactatgtggtacaaaaacgtgatgcagagagg
aaatcctggtctacagtgacaactgagtgctccaaaacaagcttcagagtatctaatttg
gaggagggaaaatcctacttcttccgagtgtttgctgaaaatgagtatggcattggtgat
cctggtgaaactcgtgatgctgtcaaagcttcccaaactcctggaccagttgtggacctg
aaagtgaggtctgtaactaagtcatcttgtagcattggctggaaaaagcctcatagtgat
ggtggaagtcggattattggatatgtagttgatttcctgactgaagaaaataagtggcaa
cgagttatgaaatccttaagcctacagtactccgcaaaagatctgactgaagggaaggaa
tataccttcagagtgagtgctgagaatgaaaatggagaaggaaccccaagcgaaatcact
gttgtggcaagggatgatgttgtggctcctgatcttgacttaaagggtctacctgatttg
tgctacttggctaaagaaaacagcaacttccggcttaagatccccataaaaggcaagcca
gctccatcagtctcctggaagaaaggggaagatcctctagcaactgacactagagtcagt
gttgagtcatctgcagttaacacaactcttatagtatacgattgccaaaaatctgatgct
ggaaaatacacaatcacacttaagaatgttgctggcaccaaggaaggaactatctccata
aaggttgttggcaagcctggcatccccactggaccaatcaaatttgatgaagtcacagca
gaagccatgaccttaaagtgggctcctccaaaggatgatggaggttctgaaatcaccaac
tatatcctagagaagagggattctgtgaacaacaagtgggtgacgtgcgcctcagctgtc
cagaaaaccacctttagagtaaccagacttcatgagggcatggaatataccttcagggtc
agtgccgaaaataaatatggtgtcggggaaggcctgaaatcagagccaattgttgctaga
catccatttgatgtgcctgatgctcccccacctcccaatattgtggaggtcagacacgat
tcagtatctctaacttggactgaccccaggaaaactggtggctctccaattacagggtat
catctcgagttcaaggaaagaaacagccttttgtggaagagagctaacaagactccgtta
aggatgagagactttaaagtgacaggattaactgaaggtcttgaatatgaattccgagtt
atggcaatcaatttagcaggtgtgggcaagccaagcctaccatcagagcctgtcgtggca
ctggacccgattgatcctcctggaaaacctgaggttattaacgtaacaaggaattcagtg
actctcatttggactgaacctaaatatgacggtggtcataagttaactggatatatagtg
gagaagcgagatctaccttccaaatcttggatgaaagccaaccacgttaatgtcccagaa
tgtgcctttactgtaactgaccttgttgagggtggaaaatacgaattcagaattagagca
aagaatacagcaggtgctatcagtgctccatcagaaagtacaggaaccattatttgcaag
gatgaatatgaggcaccaacaattgtccttgatcccacaataaaagatgggctaacaatt
aaagcaggggataccattgttttgaatgccattagcattcttggcaaaccccttccaaaa
tcaagttggtccaaggcaggaaaagacattagaccatcagatatcactcagataacttca
accccaacatcttccatgcttactatcaagtatgccactagaaaagatgccggtgaatac
accatcactgctaccaattcttttggcacgaaggaggaacatgtgaaggtaacagtcctt
gatgtacctggtcccccaggtcctattgaaattagtaatgtttctgctgaaaaagcaaca
cttacatggacacctcccttggaagatggcggctcaccaattaagtcctatatacttgaa
aagagagaaaccagtcgacttttgtggacagtggtttctgaagatattcagtcttgcagg
catgtggcaaccaaacttatccaaggaaatgagtacgtcttccgggtctcagctgtaaac
cactatggcaaaggagaacctgtacagtctgaacctgtcaaaatggtagatagatttggt
ccccctgggcctcctgaaaaaccagaggtctcaaatgtcactaagaacactgccactgtc
agctggaaaaggccagtggatgatggtggcagcgaaatcacaggatatcacgtagaaagg
agagaaaagaaaagcctgcggtgggtgagagcaataaaaacgccagtttctgatctcaga
tgcaaagtaacaggactgcaagaaggaagcacctatgaattccgtgtcagtgcagaaaac
agagcaggaattggtccacccagtgaggcttcaaattctgttctaatgaaagatgcagca
tatcctccaggaccaccttcaaatccgcatgtcactgatactaccaagaaatctgcttct
ttggcatggggcaagcctcattatgatggtggacttgaaatcaccggctatgttgtggag
catcaaaaagtaggagacgaggcctggataaaagataccacaggaactgccctcagaatc
actcagttcgttgttcctgatcttcagactaaagaaaaatacaactttagaatcagtgcc
atcaacgatgcaggtgttggggagccagcagtgattccagatgttgaaatcgtagaacgg
gaaatggctcctgattttgaactagatgccgagcttcgaagaacacttgttgttagagca
ggactcagtattagaatatttgtgccgattaaaggtcgtcctgctcctgaagtgacatgg
accaaagataatatcaacctgaaaaaccgagccaacattgaaaatacagaatcatttact
cttctgattatcccagaatgtaacagatatgataccggtaaatttgtcatgaccattgaa
aacctggctgggaagaaaagtggctttgtgaatgtcagagtcttggatacaccaggccca
gtcctcaacctgcggcctacagacatcacaaaggacagtgtcaccctgcactgggacctc
cctctgatagatggaggctcacgtataacaaattacattgtagagaaacgtgaagcaaca
cggaaatcttattccacagtcaccactaagtgccataaatgcacatataaagttaccggc
ttgtctgaagggtgtgaatacttcttcagagtgatggcagagaatgaatatggaattggt
gagccagcagaaactacagagcctgtaaaagcctctgaagcaccatctccaccagacagc
cttaacatcatggacataactaagagcactgtcagcctggcatggcctaagcctaaacac
gatggtggcagcaagatcactggctatgtgattgaagcccagagaaaaggctctgatcag
tggacccacatcacaaccgtgaaagggttagaatgtgttgtgaggaatctaactgaagga
gaggaatacaccttccaagtgatggcagtgaacagcgcggggagaagtgcccctagagaa
agcagacccgtcattgtcaaggagcagacaatgcttccagagctggatctccgtggcatc
tatcagaaactggtcattgccagagctggtgacaacatcaaagttgaaattccagtgctc
ggtcgaccaaagcccacagtgacatggaaaaaaggagaccaaattcttaaacagacacag
agagttaattttgaaaccacagcaacttcaaccattttaaatatcaatgagtgtgtcaga
agtgatagtgggccctatccattaacagcaagaaatattgtaggagaggttggtgatgtc
atcaccattcaagtccatgatatcccagggccacctactggaccaatcaaatttgatgaa
gtttcatctgattttgtaaccttctcttgggatccccctgagaacgatggtggtgtacca
ataagcaactatgtagtggaaatgcggcagactgacagtactacctgggttgagttagca
accaccgttatacgtactacctataaagccacccgccttactactggattagagtatcag
ttccgtgtaaaagctcagaatagatatggagttggaccaggcatcacatcagcatgtata
gttgccaactatccatttaaggttcctggacctcctggtacccctcaggtaactgcagtt
accaaggattcaatgaccattagctggcatgagccactttctgatggtggaagccctatt
ttaggatatcacgttgaaagaaaagaacgaaatggtattctctggcagactgtgagcaaa
gctttggtaccaggcaacattttcaaatcaagtggacttacagatggtattgcttatgaa
ttccgggtgattgcagaaaacatggcaggcaaaagcaagccaagcaagccatcagagcct
atgttggctctggatcccatcgacccacctggaaaaccaatacctctaaatattacaaga
aacacagtgacacttaaatgggctaagcctgaatatactgggggctttaaaattaccagt
tatattgttgaaaagagagaccttcctaatggacggtggctgaaggccaacttcagcaac
attttggagaatgaatttacagtcagtggcctaacagaagatgctgcatatgaattccgt
gtgattgccaaaaatgctgcaggtgccatcagtccaccatctgagccatctgatgctatc
acttgcagggatgacattgaagcaccaaagataaaggtggatgttaaatttaaggacaca
gttatattaaaagcaggtgaagcattcagactggaagctgatgtttcaggccgcccacct
ccaacaatggaatggaccaaagatggaaaagagctggaaggcacagcaaagttagaaata
aaaattgcagatttctctactcatctggtaaacaaagattcaacaagaagggatagtggt
gcctatacccttacagcaactaatcctggtggctttgctaaacacattttcaatgtcaaa
gttcttgacagaccaggcccacctgaaggacctttggctgtaactgaagtgacatcagaa
aagtgtgtattatcatggttgcctccactggatgatggaggtgccaaaattgatcattac
atagtacagaaacgtgaaaccagcagattggcatggacaaatgtagcctcagaagtccaa
gtaacaaagctaaaggtcactaaactcttgaaaggcaatgaatacatattccgtgtcatg
gctgtaaataaatatggagtgggagagccactggaatcagagcctgtgcttgcagtgaat
ccttatggaccccctgatccgcccaaaaaccctgaagtgacagctattactaaagactcg
atggttgtctgctggggacatcctgattctgatggtggaagtgaaatcatcaattatatt
gtggaacggcgtgataaagctggccaacgctggattaaatgcaacaaaaaaactcttact
gatttaagatataaagtgtctggactgacagaaggacatgaatatgagttcaggattatg
gctgaaaatgctgctggaattagtgcaccaagtcctaccagtccattttacaaggcttgt
gacactgtgtttaaacctggaccaccaggtaacccacgtgttctagatacaagcagatca
tccatttcaattgcttggaataaacctatctatgatggtggttcagaaatcactgggtat
atggttgagattgccctgccagaggaagatgaatggcagattgtcactccaccagcagga
ctcaaggcaacttcttatactatcactggcctcacagagaatcaggaatataagattcgc
atctatgccatgaattccgaaggacttggggaacctgcccttgttcctggaactccgaag
gctgaagacagaatgctgcctccagaaattgaactggatgctgacctgcgcaaagttgtt
actataagggcctgctgcaccctgagactttttgttccaatcaaaggaaggcctgcacct
gaggtgaagtgggcccgggaacatggagaatctttagataaagctagcattgaatccaca
agctcttacacactgcttattgttggaaatgtaaacagatttgacagtggcaaatacata
ctaactgtagaaaatagttcaggcagcaagtctgcatttgtcaatgttagagttcttgat
acaccaggccctccacaggatctgaaggtaaaggaggtcactaagacatctgtcacactg
acatgggacccacctctccttgatggaggttcaaaaatcaagaactatattgttgaaaag
cgagaatcaacaagaaaagcatattcaactgttgcaacaaactgccacaagacttcctgg
aaggtagaccagcttcaagaaggctgtagctactatttcagggttcttgcagaaaatgaa
tatggcattgggctgcctgctgaaaccgcggaatctgtgaaagcatcagaacgacctctt
cctccaggaaaaataactctgatggatgtcacaagaaatagtgtgtcactctcttgggag
aagccagagcatgatggaggcagccgaattctaggctacattgtggagatgcagagcaaa
ggcagtgacaaatgggccacatgtgccacagtcaaggtcactgaagctactatcactgga
ttaattcagggtgaagaatactctttccgtgtttcagctcagaatgaaaagggcatcagt
gatcctagacaactgagtgtgccagtgatcgccaaagatcttgtcattccaccagccttc
aaactcctgttcaatactttcactgtactggcaggtgaagacctaaaagttgatgttcca
ttcattggccgccctaccccagctgtaatctggcataaagatgatgtaccactgaggcag
acaactagagtaaatgcagagagcacagaaaataattcactactgacaataaaggatgcc
tgccgagaagatgttggccattatgtggttaaactgactaactcagctggtgaagctact
gaaacccttaatgttattgttcttgacaaaccagggcctccaactggaccagttaaaatg
gatgaagtgacagctgatagtattactctttcctggggcccacccaagtatgatggtgga
agttctatcaataattacattgttgagaaacgggacacttccacaaccacctggcaaatt
gtatcagctacagttgcaaggacaacaataaaggcttgcagactgaagactggatgtgaa
tatcagtttagaattgcagctgaaaacagatacggaaagagtacctacctcaattcagag
cctattgtagcccaatatccatttaaagttcctggtcctcctggcactccacttgtcaca
ctgtcctctagggacagcatggaagtacaatggaatgagccagtcagtgatggaggaagc
agagtcattggctatcatctagaacgcaaggaaagaaatagtatcctctgggttaagttg
aataaaacacctattcctcaaaccaagtttaagacaactggccttgaagaaggtgttgaa
tatgaatttagagtctccgcagagaacatcgtgggcattggcaagccgagtaaagtatca
gaatgttatgtggctcgtgacccatgtgatccaccaggacggccagaggcaatcattgtc
acaaggaattctgtgactcttcagtggaagaaacccacctatgatggtggaagcaagatc
actggttatattgttgagaagaaagaattacctgagggccgttggatgaaagccagtttt
acaaatattattgacactcattttgaagtaactggcctagttgaagatcacagatacgaa
ttccgggttatagcccgaaatgccgcaggagtgtttagtgagccttcagaaagcacagga
gcaataacagctagagatgaggtagatccaccacgaataagtatggatccaaaatacaaa
gacacaatcgtggttcacgctggtgaatcattcaagattgatgcagatatttatggcaaa
ccaataccaaccattcagtggataaaaggtgatcaggagctttcaaacacagctcgatta
gaaataaagagtactgactttgccaccaatctcagtgtaaaagatgcagtacgtgtcgac
agtggaaattacatactgaaggccaaaaatgttgcaggagagagatcagttactgtgaat
gtcaaggttcttgatagaccagggccacctgaaggacctgttgttatctcaggagttaca
gcagaaaaatgcacactagcttggaaacctccacttcaggatggtgggagtgatatcata
aattatattgtggaaaggagagaaaccagccgcttagtttggactgtggttgatgccaat
gtgcagactctcagctgcaaggttactaagcttcttgaaggcaatgaatatactttccgt
ataatggcggtaaacaaatatggtgttggtgaacctcttgaatctgagccagtaattgcc
aagaatccatttgtagtaccagatgcaccaaaagctccagaagtcacaacagtgaccaag
gactcaatgattgttgtatgggaaagaccagcatctgatggtggcagtgaaattcttgga
tatgttcttgagaaacgggataaagaaggcattagatggacaagatgccataagcgtctg
ataggagagttgcgcctgagagtaactggactcttagaaaatcacaattatgagttcaga
gtttctgctgagaatgctgctggacttagtgaaccaagccctccttctgcttaccaaaag
gcttgtgatcctatttataaaccaggacctccgaacaaccccaaagtcatagatattacc
agatcttcagtattcctatcttggagcaaaccaatatatgatggtggctgtgaaatccaa
ggatacattgttgaaaaatgtgacgtgagtgttggtgaatggacaatgtgcactccacca
acaggaattaataaaacaaacatagaagtagaaaagctgttggaaaagcatgaatacaac
ttccgtatctgtgctattaataaagctggagttggagaacatgctgatgtccctggacct
attatagttgaagaaaaattggaagcaccagacattgatcttgacctagaactaaggaaa
atcataaatataagggcaggtggctccttaaggttatttgttcctataaaaggtcgtcct
acaccagaagttaaatggggaaagatggatggtgaaattcgagatgcagctataattgat
gtcactagcagtttcacctctcttgttcttgacaatgtcaaccgatatgatagtggaaaa
tatacacttacattagaaaacagcagtggaacaaagtctgcctttgttactgtgagagtt
ctggacacgccaagtccacctgttaacctgaaagtcacagaaatcaccaaagactcagta
tcaattacatgggaacctcctttgttggatgggggatccaaaataaaaaattacattgtt
gagaaacgtgaagccacaagaaaatcatatgctgctgttgtaactaattgccataagaat
tcttggaaaatcaatgagctccaagaaggttgcagttattacttcagagtcacagctgag
aatgagtatggtattggccttcctgcccagactgctgatccaattaaggttgcagaagtc
ccacaacctcctggaaaaataactgtggatgatgtcaccagaaacagtgtctctctgagt
tggacaaaacctgaacatgatggtggcagtaaaatcattcagtatattgtggaaatgcaa
gctaaacacagtgagaaatggtcagagtgtgctcgagtaaagtctcttgaggcagtaatt
tccaacctaactcaaggggaagaatatctttttagagttgttgctgtaaatgaaaagggg
agaagtgaccctcggtcccttgcagttccaatagttgccaaagatctggtaattgagcca
gatgtaaaacctgcattcagtagttacagtgtacaggttggccaagatttgaaaatagaa
gtgccaatttctggacgtcctaagccgacaattacctggactaaagatggtctcccactg
aagcagaccacaagaatcaacgttactgattcactggatctcaccacactcagtattaaa
gaaactcataaggatgatggtggacaatatggaatcatggttgccaatattgttggtcag
aagacagcatccatcgaaattgtaactctagataaacctgatcctccaaaaggacctgtt
aaatttgatgatgtcagtgctgaaagtattacattatcttggaaccctccattatataca
gggggctgccaaatcaccaattacattgttcagaaaagagatacaaccaccacagtatgg
gatgttgtttctgctactgttgctagaactacactcaaagtgaccaaactgaaaactggt
acagaataccaatttagaatatttgctgaaaatagatatggacaaagttttgccttagaa
tctgatccaattgtagctcaatatccctacaaagaaccaggccctccagggacaccattt
gccacagccatttccaaagactccatggtaatacagtggcatgaaccagtcaacaatggt
ggaagcccagtcataggttaccacctggagaaaaaagaaagaaatagtattttgtggaca
aaggtcaacaaaactattattcatgacacccaattcaaagcacagaatcttgaagaaggc
attgaatatgaattcagagtgtatgcagaaaatattgttggtgtaggcaaagcaagcaag
aattctgaatgctatgtagccagagatccctgtgaaccaccaggaaccccagaaccaata
atggttaaaagaaatgaaatcactttacagtggaccaaacctgtatatgatggtggaagt
atgattacaggctacattgtagagaaacgtgatttgcctgatggtcgttggatgaaagcc
agctttacaaatgtcattgaaactcaatttactgtgtcaggtcttactgaagatcaaaga
tacgaattcagagtcattgcaaagaatgccgctggtgcaataagtaaaccctctgacagt
actggaccaataactgccaaggatgaggttgaactcccaagaatttcaatggatccaaaa
ttcagagacacaattgtggtaaatgctggagaaacattcagacttgaggctgatgtccat
ggaaagcccctacctaccattgagtggttaagaggagataaggaaattgaagaatctgct
agatgtgaaataaagaacacagatttcaaggctttacttattgtaaaagatgcaattaga
attgatggtgggcagtatattttaagagcttccaatgttgcaggttctaagtcattccca
gtaaatgtaaaagtattagatagaccaggacctccagaagggccagtccaggttactgga
gtcacttctgaaaaatgctctttaacatggtctccaccacttcaagatggtggcagtgac
atttctcactatgttgttgaaaagcgagaaaccagtcgacttgcctggactgttgttgct
tcagaagttgtaaccaattctctgaaagttaccaaactcttagaaggtaatgaatatatt
ttccgtataatggctgtcaacaaatatggtgttggagagcctttggaatctgcaccagta
ctaatgaaaaatccatttgtgcttcctggaccaccaaaaagcttggaagtcacaaatatt
gccaaagactccatgaccgtctgttggaaccgtccagatagtgatggtggaagtgagatt
attggttacattgtagagaaaagagacagaagtggcattcgatggataaaatgtaataaa
cgccgcattacagatttgcgtctaagagtgacaggattaacagaagatcatgagtatgaa
ttcagggtctctgcagaaaatgctgctggagttggggaaccaagtccagctacagtttat
tataaagcctgtgatcctgtgttcaaacctggcccacccaccaatgcacacattgtagac
accaccaaaaattcaatcacacttgcctggggtaaacccatctatgatggtggcagtgag
atcctgggatacgtagtagaaatctgcaaagcagatgaagaagaatggcaaatagttact
ccacagactggcctgagagttactcgatttgaaatttcaaaactcactgaacaccaagag
tataaaatacgagtctgtgccctcaacaaagttggtttaggtgaggctacatcagtgcct
ggtactgtgaaaccagaagataaacttgaagcacctgaacttgaccttgactctgaatta
agaaaaggaattgttgtaagagctggtggatctgccagaattcacattccattcaaaggt
cgtccaacgcctgagatcacttggtctcgagaggaaggtgaattcacagataaggtccaa
attgaaaagggagtaaactatacccagctatcaatagataactgtgatagaaatgatgct
ggaaaatacattcttaagttggaaaacagcagtggatcaaagtctgcttttgtaactgtg
aaagttcttgacactccaggaccaccacagaatttggcagtcaaagaagtgagaaaagat
tctgtcctcctggtatgggagccacccatcattgatggaggtgcaaaggtcaaaaactat
gtgattgacaaacgtgagtcaaccagaaaagcgtatgctaatgtgagtagtaaatgtagc
aaaacaagttttaaagtggaaaatcttacagaaggagccatttattacttcagagtcatg
gctgaaaatgaatttggagttggtgttccagtggaaactgttgatgccgtgaaagctgct
gaacctccttccccgccaggaaaggttacactcactgatgtgtcccagaccagtgcatca
cttatgtgggagaaacctgaacatgatggtggtagcagaatcctggggtatgttgttgaa
atgcagcccaaaggaactgaaaaatggagcattgtggccgaatccaaagtctgtaatgca
gttgttactggtttgagttctggacaagaatatcagttccgtgtcaaggcttataatgag
aagggaaaaagcgatccaagagtgctgggtgttcctgtcatagccaaggacttgactata
cagcctagtttaaagttaccatttaacacatatagtatccaagctggagaaggtcttaaa
atagaaattccagttataggccgaccaagacctaacgtttcttgggtcaaagatggtgag
cctcttaaacagacaacaagagtaaacgttgaagaaacagctacctcaactgttttgcac
attaaagaaggtaacaaagatgactttggaaaatataccataacagcaacaaatagtgca
ggcacagcaacagaaaatctcagtgttatcgttctagaaaagcctggacctccaattggc
ccagttcggtttgatgaagttagtgcagactttgtagtcatatcttgggaacctccagcc
tatactggtggctgccaaataagcaactacattgtagagaagcgagatacaaccaccacc
acttggcacatggtatcagcaacagttgcaagaacaacaattaaaataaccaaactgaaa
acaggcacggagtaccagtttagaatttttgctgaaaacaggtatggaaaaagcgcccca
ctggattctaagccaattattgtacagtatccatttaaagaacctggaccacctggaact
ccttttgtgacatcaatctcaaaagatcaaatgcttgtgcaatggcatgagccagttcat
gatggaggcaccaaaattattggctaccatcttgaacagaaagaaaagaacagtatttta
tgggtcaagttaaataagacccccattcaggacaccaaattcaaaacaactgggcttgat
gagggccttgagtatgagttcaaagtttctgctgaaaatattgttggcattggcaagcct
agcaaagtgtcggaatgttttattgctcgtgatccatgtgacccacctggtcgccctgaa
gccattgttattacaagaaacaatgtcacactgaaatggaagaaacctgcctatgatggt
ggtagcaaaataacaggttacctggtagaaaagaaagatctacctgatggccgctggatg
aaagccagctttaccaacgtattagaaactgaatttacagtgagtggacttgtagaagac
caaagatatgaatttagagtaattgcaagaaatgcagctggaaactttagtgaaccatct
gaaagtagtggtgccattactgcaagagatgaaattgatgcaccaaatgcctctctggat
ccaaaatataaagatgtcatcgttgttcatgcaggagagacttttgttcttgaagccgac
atccgtggcaaacctatacctgatgttgtttggtcaaaagatggaaaagaacttgaagaa
acagctgctagaatggaaattaaatctactattcagaaaacaactcttgttgtcaaagac
tgtatacggactgatggaggacaatatattctgaaactcagcaatgttggtggtacaaag
tctatacccatcactgtaaaggtacttgacaggccagggcctcctgaagggcctcttaaa
gttactggagttactgcagaaaaatgttacctggcatggaacccacctttgcaagatggt
ggtgctaatatttcacattacatcattgaaaagagggagacaagccgactctcttggacc
caggtttcaactgaggtacaggcccttaactacaaagttactaaacttcttcctggtaat
gagtacattttccgtgtcatggctgtgaataaatacggaattggagagcccttggaatct
gggcctgttacagcctgtaatccttataagccaccaggtcctccttcaacacctgaagtc
tcagcaatcactaaagattctatggtagtaacatgggcacgcccagtagacgatggaggt
gctgaaattgagggctacattcttgaaaaacgagataaggaaggcgttagatggaccaag
tgcaacaagaaaacattaacggatctccggctcagggtaactggtcttaccgaaggccat
tcctatgaattcagagttgctgctgaaaatgcagctggtgtgggagaacctagtgagcca
tctgttttctaccgtgcatgtgatgccttgtatccaccaggtccaccaagcaatccaaaa
gtgacggacacttccagatcttctgtctccctggcatggagtaagccgatttatgatggt
ggtgcacctgttaaaggctatgttgtagaggtcaaagaagctgctgtggatgaatggaca
acctgcactccaccaacaggattacaaggaaagcagttcacagtgaccaagcttaaagaa
aatactgaatataacttccgtatttgtgccatcaattctgaaggtgtaggtgaacctgca
actctacctggttcagtggttgctcaggagaggatagagccaccagaaatagaacttgac
gctgatctcagaaaggtggttgttctgcgtgcaagtgctactttacgcttatttgtcact
atcaaaggtcgaccagaacccgaagttaaatgggaaaaggcagaaggcattctcactgac
agggctcagatcgaggtgaccagctcatttacaatgttggtgattgataatgttaccaga
tttgacagtggtcggtataatctgacattagaaaataatagtggctccaaaacagctttt
gttaacgtcagagttcttgactcaccaagtgcccctgtgaatttgactgtaagagaagtg
aagaaagactcagtgatgttgtcctgggaaccgccacttattgatggtggagctaagatt
acaaactacattgtcgaaaaacgagaaactacaagaaaagcctatgctactgttacaaac
aattgcactaaaactactttcagaattgaaaatctacaagaaggatgttcttactacttc
cgagtcttggcttccaatgaatatgggattggtttgccagctgaaacaacggaacccgtt
aaagtgtctgaaccacccctcccacctggaagagtaactcttgttgatgtgacccgtaat
acagctacaattaagtgggagaaaccagaaagtgatggtggcagcaaaattattggttat
gtggttgaaatgcagactaaagggagtgaaaagtggagcacctgcacacaagttaagact
ctagaagcaactatatctggcttaactgcaggagaagagtatgtcttcagggtagctgca
gttaatgaaaagggaagaagtgatccaagacaacttggagtgccagtaattgcaagggat
attgaaataaagccttcagttgagcttcctttccatactttcaatgtaaaggctagagaa
caacttaagattgatgtgccattcaaaggaagacctcaagctactgtgaactggaaaaaa
gatggtcagactcttaaagagacaactagagtcaatgtttcttcttcaaagactgtaaca
tcactatctattaaggaagcttcaagggaagatgttggaacttatgaattatgtgtttca
aacagtgctggatccataacagttcctcttactataattgtccttgacagaccgggacct
ccaggtcctatacgtattgatgaggttagttgtgacaacataaccatttcttggaatcct
ccagaatatgatgggggctgccaaattagcaattacatcgttgaaaagagagaaaccacc
tctacaacatggcacatagtttcacaagcagttgcaagaacatccattaaaatagttcgc
ctgaccacaggaagtgagtatcagttccgtgtttgtgcagaaaaccgctatggaaagagc
tcctacagtgaatcttcagctgttgttgcagagtatccattcagtcccccaggtcctcct
ggtactcctaaagttgtgcatgccacaaaatctaccatgcttgtaacctggcaagtgcca
gttaatgacggaggaagtcgagtaattggctatcatcttgagtataaagaaagaagcagc
attctttggtcaaaagcaaataaaatcctcattgctgatactcaaatgaaagtctccggc
cttgatgaaggactgatgtatgagtatcgtgtatatgctgagaatattgctggaatcggt
aaatgcagtaaatcttgtgaaccagtccctgcaagagatccttgtgatcctcctggacaa
cctgaagtcacaaatatcacaagaaaatcagtgtcacttaaatggtctaaaccacattat
gatggtggagctaagatcacaggatacattgttgaacgcagagaactaccagatggccgg
tggctgaaatgcaattatactaatatacaggaaacacactttgaagtaactgaacttact
gaagatcagcgttatgaattccgggtttttgcaaagaatgctgctgactcagttagtgaa
ccatctgaatccactgggcctattacagttaaagatgatgttgaggctccaagaattatg
atggatgtcaagttccgagacgttattgttgtcaaagctggagaagtccttaagataaat
gcagacattgcagggcgacctctgccagtaatttcctgggccaaggatggtgtagaaatt
gaagaaagagcaagaacagaaatcatctcaacagacaatcatactttattaacagttaaa
gactgtgtaagacgagacactgggcaatatgtactaacactgaagaatgttgccggcact
cggtctgtggccattaattgcaaggtacttgataagcctggtccaccagcaggaccactt
gaaataaatggcctcactgctgagaaatgctctctttcctggggacgcccccaagaagat
ggtggtgcagatatcgactattacatcgtagaaaaacgtgaaacaagccaccttgcgtgg
acaatatgtgaaggagagttacggacgacatcctgtaaagtaaccaagttactcaaaggc
aatgaatatatatttagagtaactggtgttaataaatacggtgttggtgagcccctagag
agtgtagctgtaaaggcactagatccatttacagttccaagtccacccacatctttggaa
attacttctgtgacgaaagaatctatgacgctttgctggtcaagacctgagagtgatgga
ggtagtgaaatatctggatatataattgaaagacgagagaaaaatagcctaagatgggtg
cgtgtaaacaaaaaaccagtttatgatctgagagtgaaatcaacaggacttcgggaagga
tgtgaatatgaatatcgtgtttatgcagaaaatgctgctggcctaagtcttccaagtgaa
acctctcccttaattcgggcagaagatccagtattcctaccatctcctccatctaaaccc
aaaattgtggactcaggcaagacaactataactattgcctggcttaagccgctgtttgat
ggtggggccccaataactggatatactgttgaatacaaaaaatctgatgacactgactgg
aaaactgccattcagagcttacgagggacagaatatacaataagtggactaacaacagga
gctgaatatgttttcagagtaaaatctgtcaataaggttggtgctagtgaccccagtgat
agctccgaccctcagatagcaaaggaaagagaagaagaacctgtatttgatattgacagt
gaaatgaggaagactttgattgtcaaggctggtgcctcatttaccatgactgtgcctttc
cgaggaagaccagtacccaatgtcttgtggagtaagccagacactgacctccgcactaga
gcttatattgataccacagactctcgtacctcactgaccattgaaaatgccaacagaaat
gactctggaaagtacacattaacaattcagaatgttttgagtgctgcttcattgacctta
gttgtgaaagttttagattccccaggtcctccaaccaacattgctgtgcaagatgtaacc
aaagagtctgcagtgttatcctgggatgttcctgaaaacgatggtggagcaccagtgaag
aattaccacatagaaaaacgtgaggccagcaagaaagcatgggtctctgtgaccaacaac
tgtaaccgcctctcctacaaagttaccaatttacaagaaggagctatctactacttcaga
gtctctggagaaaatgagtttggtgttggtatgccagctgaaacaaaggaaggagtaaaa
ataacagaaaaaccaagcccacctgaaaaacttggagtaacaagtacatccaaagacagt
gtttccctgacctggctgaagcctgaacatgatggcggaagcagaattgtacactatgtc
attgaagcactagaaaaaggacagaaaaactgggttaaatgtgcagtggcaaagtcaacc
catcacgttgtttctggtctgagggagaattctgaatactttttccgggtgtttgctgaa
aatcaagctggcctgagtgacccgagagagcttctgcttcctgttcttattaaggagcaa
ctagaaccacctgaaattgatatgaagaatttcccaagtcacaccgtatatgttagagct
ggttcaaaccttaaagttgacattccaatctctggaaaaccacttcccaaagtgacctta
tcaagagatggtgtccctctgaaggcaaccatgagatttaataccgaaattactgctgag
aacctgaccatcaatctcaaagaaagtgttacagctgatgctgggagatatgagatcact
gctgccaactccagtggtacaaccaaagctttcattaacattgttgtgctggacaggcct
ggtcctccaactggccctgtcgttattagtgatataactgaagaaagtgtgactctcaag
tgggagccacctaagtatgacggtggaagtcaagttaccaactacgttctacttaaaaga
gaaacaagtactgcagtatggaccgaagtgtctgcaacagttgcaagaaccatgatgaaa
gtcatgaaactgaccacaggagaagaataccaattccgcatcaaggcagaaaaccgcttt
ggcatcagtgatcacatagattcagcttgtgtgactgtcaaactaccatacacaacgcct
ggaccaccatctacaccatgggtcactaatgttactcgagaaagcatcactgtgggctgg
catgaaccagtgtcaaatggaggcagtgcagtcataggctatcacctggaaatgaaagac
agaaacagtattttatggcaaaaagccaacaaactggtcatccgcactactcacttcaaa
gtcacaacaatcagtgctggacttatttatgaattcagggtgtatgcagaaaatgctgct
ggagttggaaaacccagccatccctctgaaccagtcttggcaattgatgcttgtgaaccc
ccaagaaatgttcgtatcactgatatttcaaagaactctgtcagcctttcgtggcaacaa
ccagcttttgatggaggtagcaagattacaggctacattgttgaaagacgtgaccttcca
gatggcagatggaccaaggccagcttcaccaatgttactgaaactcaattcaccatctct
ggcttgactcagaattcccagtatgaattccgtgtctttgctaggaatgctgttggttcc
attagcaatccatctgaggttgtagggcccattacttgcatcgattcttatggtggtcct
gtaattgatttgcctctagaatatacagaagttgtcaaatacagagcaggtacatctgtg
aggctcagagctggcatttctgggaaacctgcgcctacaattgagtggtataaagatgat
aaagaattacaaaccaatgcactggtttgtgtcgaaaataccacggacctcgcatctata
ctcatcaaagatgccgatcgccttaatagtggatgctatgaattaaaactaaggaatgcc
atgggctcagcctcagccaccatcagagtacagatccttgacaaaccaggcccacctggt
ggaccaattgaatttaagactgtaactgctgaaaagatcaccattctctggcggcctcca
gctgatgatggtggtgcaaaaatcactcactacattgtggaaaagcgtgagacaagccgc
gttgtgtggtctatggtgtctgaacatttggaagagtgcatcattacaaccaccaaaatt
atcaaaggaaatgaatatatcttccgggtccgagccgtcaacaaatatggaattggcgag
ccactggaatctgattccgttgtagccaagaatgcatttgttacacctgggccaccaggc
ataccagaagtgacaaagattaccaagaattcaatgactgttgtatggagcaggccaatt
gcagatggtggtagtgatataagtggctatttccttgaaaaacgagataagaagagtcta
ggatggtttaaagtactaaaagagacaatccgtgacaccagacaaaaagtaacaggactc
acagaaaacagtgactatcaatacagagtttctgctgtaaacgctgctggacagggtccc
ttttctgaaccatctgaattctacaaagctgctgatcctattgatcctccaggcccacct
gctaagataagaattgcagattcaaccaagtcatccatcacccttggctggagtaagcct
gtctatgatgggggcagtgctgttactgggtatgttgttgagatgagacaaggagaggaa
gaggaatggactattgtctctaccaaaggagaggtcagaactacagaatatgtggtatcc
aatctgaaacctggagtcaattactacttccgggtatctgctgtaaactgtgctggacaa
ggagaacctatagaaatgactgaacctgtacaagctaaagatatacttgaggcaccagag
attgacctggatgtggccctcagaacttctgttattgccaaagctggtgaagatgtacaa
gtgttgattccctttaaaggtagacctccacctactgtcacatggagaaaagatgagaag
aatcttggcagtgatgccagatacagcattgaaaacactgactcatcttcattactcacc
attcctcaagttactcgcaatgacacaggaaaatatattctcacaatagaaaacggagtt
ggtgaacctaagtcttcaactgtgagtgttaaagtgcttgacacaccagctgcctgccag
aaactacaggttaaacatgtttctcgaggcacagtcactttgctctgggatcctcctctc
atcgatggaggatctccaataattaattacgtaattgaaaagagagatgccaccaagaga
acatggtctgtcgtgtcacacaaatgttctagcacatccttcaagctaacagagttgtca
gagaagactccattcttcttcagagttcttgcagaaaatgaaattggaattggggaaccc
tgtgaaactacggagccagtgaaggctgctgaagtaccagctcctatacgtgatctctca
atgaaagactcaacaaagacatctgtcatcctcagctggaccaaacctgactttgatggt
ggtagcgtcatcacagaatatgttgtagaaaggaaaggtaaaagtgaacagacatggtcc
cacgctggcataagtaagacatgtgaaattgaggttagccaacttaaggagcagtcagtc
ctggagttcagagtgtttgccaaaaatgagaaaggactgagtgatcctgtcactattggg
ccaattacagtgaaagaacttattattacgcctgaagttgacctgtcagatatccctggg
gcacaagtcactgtgagaattgggcacaatgtgcaccttgaattaccttataaaggaaag
cccaaaccatccatcagttggctgaaagatggcttgccactgaaagaaagtgaatttgtt
cgtttcagtaaaactgaaaacaaaattactttgagtattaagaatgccaagaaggagcat
ggaggaaaatacactgttattcttgataatgcagtgtgtagaaatgcagtccccattaca
gtcatcacccttggcccaccatcaaagcccaaaggacccattcgatttgatgaaatcaag
gctgatagtgtcatcctgtcatgggatgtacctgaagatgatggaggaggagaaattact
tgttacagcatcgagaagcgggaaacttcacaaacgaattggaagatggtgtgttcaagt
gttgccaggacgactttcaaagttcctaatctagtcaaagacgctgagtaccagtttaga
gtgagggcagaaaacagatacggagtcagccaaccacttgtctcaaacattattgtggca
aaacaccagttcaggattcctggtcccccaggaaagccagttatatacaatgtgacttct
gatggcatgtcactaacttgggatgctccagtttatgatggtggttcagaagttactgga
ttccacattgaaaagaaagaaagaaatagcatcctctggcaaaaagttaatacatcacca
atctctggaagagaatatagagctactggactggtggaaggtctggattaccaattccgt
gtatatgctgaaaattctgctggcctaagctcacctagtgacccaagcaaatttacctta
gctgtttctccagtagacccacctggcactcctgactacattgatgtcacccgggaaacc
atcacacttaaatggaacccaccattgcgtgatggaggcagtaagattgtggcctatagc
attgagaaacggcaaggaaatgaacgctgggtgagatgcaactttactgacgtcagtgaa
tgtcagtacacagttacaggactcagtcctggggatcgctatgagttcagaataattgca
agaaatgctgttggaactataagcccgccctcacagtcttctggcattattatgacaaga
gatgaaaatgttccaccaatagtagagtttggccctgagtactttgatggtctcattatt
aagtctggagaaagccttagaattaaagctttggtacaaggaagaccagtgcctcgagta
acttggttcaaagatggagtggaaatcgaaaagaggatgaatatggaaataactgatgtc
cttggatccaccagcctatttgttagagatgctactcgggaccatcgtggtatatacaca
gtggaagccaaaaatgcatctggttctgcaaaagcagaaattaaagtgaaagtacaagat
acaccaggaaaagtagttgggccaataagattcaccaatattactggggagaagatgact
ctgtggtgggatgctccactcaatgacggttgtgctcccataacccactacatcattgaa
aaacgggaaaccagcagacttgcttgggcactaattgaggataaatgtgaagcccaaagt
tacactgccattaaactaataaacggcaatgaataccaattccgtgtttctgcagttaac
aagtttggtgttggcaggccacttgattctgatccagtggttgctcaaatacaatacact
gttcctgatgcccctggcactccagaacctagcaatgtaacaggcaacagcattaccctg
acatgggcaaggccagaatcagatggtggcagtgaaattcaacagtatatccttgaaaga
agagaaaagaaaagcacaagatgggtaaaagtgatcagtaaacgaccaatctctgaaaca
agattcaaagtcaccggtctgacagaaggcaatgagtatgaattccatgtcatggctgaa
aatgctgcaggagtcggacctgcaagtggcatctcaagactcattaaatgtagagagccc
gtcaacccaccaggtcctcctgcagtggtcaaagtaacagacacatcaaagacaactgtg
agcttagaatggtccaaaccagtgtttgatggtggcatggaaataattgggtacattatt
gaaatgtgcaaggccgacttaggagactggcacaaggtgaatacagaggcatgtgtgaaa
acaagatatacagtcactgatctacaagcaggtgaagaatacaaattccgagttagtgct
atcaatggtgctggaaaaggagacagctgtgaagtgaccggcacaattaaagcagttgac
cggttaacagctcctgagttagacatagatgcaaacttcaaacagactcatgttgttaga
gctggggccagtattcgcctcttcattgcctaccaaggtagacctactcctacagctgtg
tggagcaaaccagactctaaccttagccttcgggctgatatccatacaacagactccttc
agcaccctcactgtggaaaactgcaacagaaatgatgcagggaaatatacccttactgtg
gaaaacaacagtggtagtaagtcaatcacattcaccgtaaaagtgctagacactccaggc
ccacctggcccaattaccttcaaagatgtgacccggggatcggctacattgatgtgggat
gcccctcttcttgatggtggtgcccgaatccatcactatgtggttgagaaacgagaggca
agtcgccgtagttggcaggttatcagtgaaaaatgcactcgtcagatcctcaaggtcggt
gatctggcagaaggtgttccatactatttccgtgtttctgcagtaaatgagtatggtgtt
ggtgagccctatgaaatgccagaaccaattgtagccacagaacagcctgctccacctaga
agacttgatgttgttgatactagcaaatcctctgcagtcttagcttggcttaaacctgag
catgatggaggcagccggatcactggctacctgcttgaaatgagacaaaagggatctgac
ttctgggttgaagctggtcacaccaaacagctgactttcacagtagagcgtcttgttgag
aacactgaatatgaattccgtgtgaaggctaagaatgatgctggctacagtgaacccagg
gaagccttctcttctgtcatcattaaggagcctcaaatcgagcccactgctgacctcact
ggaattaccaatcagcttataacttgcaaagcaggaagcccatttaccattgacgtacca
atcagtggtcgtcccgcccccaaagtaacatggaaactggaagaaatgagacttaaagag
acggatcgagtgagcattacaacaacaaaagacaggaccaccctgactgtaaaggagagc
atgagaggtgactctggaagatacttcttgaccctggaaaatacagctggtgttaaaaca
tttaccgtcacagttgtggtcattggaaggccaggtccagtaaccggccccattgaggtc
tcatctgtttcggctgaatcgtgtgtcctgtcatggggagaacctaaagatgatggaggc
actgaaattactaattacatagttgaaaagcgtgaatcgggtacaacagcttggcatctt
gtcaattccagtgtcaagcgcactcaaattaaagtcactcatctcacaaaatacatggaa
tattctttccgtgtcagttcagagaacagatttggtgtcagcaaacctctagaatcagca
ccaatagttgctgaacatccatttgtcccaccaagtgctcctaccagacctgaggtctac
tatgtgtctgccaatgccatgtctattcgttgggaagaaccctaccacgacggtggcagt
aaaatcattggctactgggttgagaagaaagaacgtaacacaattctttgggtgaaagaa
aacaaagtgccatgcttagagtgcaactacaaagtaactggtttagtagaaggactggaa
tatcagttcagaacttatgcactcaatgctgcaggtgttagcaaggccagcgaagcttca
agacctataatggctcaaaacccagttgatgcaccaggcagaccagaggtgacagatgtc
acaagatcaacagtatcactgatttggtctgccccagtgtatgatggaggcagcaaggtt
gtgggctacatcatagagcgtaagccagtcagtgaggtaggagacggtcgctggctgaag
tgcaactataccattgtatctgacaatttcttcaccgtgactgctctcagtgaaggagac
acttatgagttccgtgtgttagccaagaatgcagcaggtgtaattagcaaagggtctgaa
tctacaggccctgtcacttgccgagatgaatatgctccacccaaagctgaactggatgcc
cgattacagggtgatctggttaccatcagagcaggttctgatcttgttctggatgctgca
gttggtggcaaacctgaacccaaaattatctggaccaaaggagacaaggagctagatctc
tgtgaaaaagtctctttgcagtatactggcaaacgagcaactgctgtgatcaagttctgt
gacaggagtgacactggaaaatacactttaacagtgaaaaacgccagcgggaccaaggcc
gtgtctgtcatggtcaaagtgcttgattcccctggcccatgtggaaagctcaccgtcagc
agagtaacagaggagaagtgcactttagcctggagccttcctcaggaagacggaggagca
gaaatcactcactacatcgtggaaagacgcgagactagcaggctcaactgggtgattgtt
gaaggcgaatgcccaaccctatcctatgtcgttaccaggctcatcaagaacaatgagtac
atattccgagtgagggcagtaaacaaatatggccccggtgtgcctgttgaatcagagcca
attgtagccagaaactcattcactattccatcaccacccggcatacctgaagaagttggg
actggcaaagagcatatcatcattcagtggacaaaacctgaatctgatggtggcaatgaa
atcagcaactacctagtagacaaacgtgagaagaagagcctgcgctggacacgtgtcaac
aaagactatgtcgtgtatgataccaggctgaaggtgatgagcctgatggagggttgtgat
taccagttccgagtgactgcagtgaatgcagctggtaacagtgagcccagcgaagcttcc
aacttcatctcatgcagagaaccatcatatacccctggaccaccttctgctccaagagtt
gtggataccaccaaacacagcattagtttggcatggaccaaacccatgtatgatggtggt
gctgacatcacaggatatgttctggaaatgcaagagaaggacactgatcagtggtaccga
gtgcataccaaagccacaataagaaatactgaattcactgtgccagaccttaaaatgggt
cagaaatattccttcagagttgctgccgtgaacgtgaagggtatgagcgaatacagtgaa
tcgattgctgaaattgagcccgtggaaagaatagaaataccagatctcgagcttgcagat
gatctaaagaagactgtgaccatcagggctggggcctccttgcgcttgatggtgtctgta
tctggaagaccacctcccgtcatcacgtggagcaagcagggcattgaccttgcaagtcgg
gcaattattgacaccactgagagctactcattgctaatagtggacaaagttaatcggtat
gatgctggaaaatacacaattgaagctgaaaaccaatctggcaagaaatcagcaacagtc
cttgttaaagtctatgatactcccggtccttgtccttcagtgaaagttaaggaagtatca
agagattctgtgactataacttgggaaattcccacgattgatggtggagctccagtcaac
aattacatcattgagaaacgtgaagctgccatgagagcattcaaaacagtaactaccaaa
tgcagcaagacactttacagaatttctggacttgtagaaggaaccatgtactatttcaga
gtgctgccagaaaatatttatggcattggtgaaccctgtgaaacatctgatgcagtactg
gtctcagaagtgcctttggtgcctacaaagctagaagtggtcgatgtcaccaaatccact
gttacccttgcctgggaaaaaccactctatgatggtggtagccgactcactggatatgtt
ctcgaggcctgcaaagctggcacagagagatggatgaaggttgtcaccttaaaacccaca
gtcctagagcacactgttacttccttaaatgaaggtgaacaatacttatttagagtgagg
gcacaaaatgagaaaggtgtgtcagaagcaagagagattgtcacagccgtgactgtacaa
gacctcagagtgttgccaacaatcgatctttctacaatgcctcagaagactatccatgtc
ccagctggcagaccaatagagctggtgatacctattgctggccgtccacctcctgctgct
tcctggttctttgctggttctaaactgagagaatcagagcgtgtcacagttgaaactcac
actaaagtagctaaattaaccatccgtgaaaccactatcagagatactggagaatacaca
cttgaactgaagaatgttactggaactacttcagaaaccattaaagttatcattcttgac
aagcctggtccaccaacaggacctattaggattgatgaaattgatgctacatcaattacc
atttcctgggaaccacctgaattggatggtggtgctccattgagtggttatgtggtagaa
caacgtgatgctcatcgtccaggatggctgcccgtttctgaatcagtgactaggtccacg
tttaagtttaccagactcactgaaggaaatgagtatgtgttccgtgtggctgcaacaaac
cgcttcgggattggctcttacttgcagtctgaggtcatagagtgtcgcagcagcatccgt
attcctggacccccagaaacattacagatatttgatgtctcccgtgatggtatgacactt
acttggtacccaccagaggatgacggtggctcccaagtgactggatacattgtggagcgc
aaagaagtgagagcagatcgatgggtccgtgtaaataaagtacctgtgacaatgacacgg
taccgctccactggccttattgaaggcttagaatatgaacaccgtgtcacagccattaat
gcaagagggtctggaaaaccaagtcgtccttccaaacccatcgttgccatggatccaatt
gctcctccaggaaagccacaaaacccaagagttactgatacaacaaggacatcagtctcc
ctggcctggagcgttccagaagatgaaggaggatctaaagtcacaggctacttgattgaa
atgcaaaaagtagatcaacatgaatggaccaagtgtaacaccactccaaccaagattcga
gagtatactctaacacacctacctcagggtgcagaatacaggttccgcatcctagcttgt
aatgctggtggacctggtgagcctgctgaggtaccaggaacagtcaaagtcactgaaatg
cttgaatatcctgattatgaacttgatgaaagataccaggaaggtatcttcgtaaggcaa
ggtggagtcatcagacttaccataccaatcaaaggaaaaccattcccaatatgtaaatgg
accaaggaaggccaggatattagtaagcgtgccatgattgcaacatctgaaacacatact
gagcttgtgatcaaagaagcagacaggggtgattctggcacttacgacctggttctggaa
aataaatgtggcaagaaggctgtctacatcaaggtcagggtgataggaagtcccaatagt
ccagaagggccactggaatatgatgacatccaagcccgctctgtgagggtcagctggaga
cctcctgctgatgatggtggtgctgacatcttaggttacatcctcgagagacgagaagtg
cctaaagccgcctggtataccattgattccagagtccgaggtacatctctggtggtcaaa
ggccttaaagagaatgtagaataccatttccgtgtttcagcagaaaaccagtttggcata
agcaaacccttgaaatctgaggaaccagtcataccaaaaacaccactgaatcctccagaa
cctccaagcaatcctccggaagtactcgatgtaaccaagagttctgttagcttgtcctgg
tcccggcccaaagatgatggtggttctcgagtcacaggctactacattgaacgcaaagag
acatccactgacaagtgggtcagacacaataagactcagatcactaccacaatgtatact
gtcacggggcttgttcccgatgctgagtatcagttccgcatcattgcacagaatgatgtt
ggcctaagtgagaccagccctgcttctgaaccagttgtttgcaaagatccatttgataag
ccaagccaaccaggagaacttgagattctttcagtatccaaagatagtgtcactctacag
tgggagaaacctgaatgtgatggtggcaaagaaattcttggatactgggttgaatataga
cagtctggagacagtgcctggaagaagagcagtaaggaacggattaaggacaagcaattc
acaatagggggtttgctggaagctactgaatatgaattcagggtttttgctgagaatgag
actgggctgagcagacctcgaaggactgctatgtctataaagactaaactcacatctgga
gaggccccaggaatacgcaaagaaatgaaggatgttaccaccaaattgggtgaagctgct
caactctcatgccagattgttggaaggcctcttcctgacattaaatggtacagatttggt
aaagagctcatacaaagccggaaatacaaaatgtcttcagatggacgcacacatactctt
acagtaatgacagaggaacaggaagatgaaggtgtttatacctgcatagccaccaatgag
gttggagaagtagaaaccagtagtaagcttctcctgcaagcaacaccacagttccatcct
ggttacccactgaaagagaaatattatggagctgtgggttctacacttcggcttcatgtt
atgtacattggtcgtccagtacctgccatgacttggttccatggtcagaaacttttgcaa
aactcagaaaacattactattgaaaacactgagcactatactcatcttgtcatgaagaac
gtccaacgtaagacgcatgctgggaaatacaaagtccagctcagcaatgttttcggaaca
gttgatgccatccttgatgtggaaatacaagataaaccagacaaacctacaggaccaatt
gtgatcgaagctctattgaagaactctgcagtgatcagctggaaaccacctgcagatgat
ggaggctcctggatcaccaactatgtggtggaaaaatgtgaggccaaggagggggctgaa
tggcaattggtgtcttcagccatctcagtgacaacctgtagaattgtgaacctcacagaa
aatgctggctattacttccgggtttcagctcagaatacttttggcatcagtgaccctcta
gaagtgtcctcagttgtgattattaagagtccatttggaaagccaggtgctcctggcaaa
ccaactatcaccgctgtcacaaaagattcatgtgttgtggcttggaagccacctgtcagt
gatggaggtgcaaagattagaaattactaccttgagaagcgcgagaagaagcagaataaa
tggatttctgtgacaacagaagaaattcgagaaactgtcttttcagtgaaaaaccttatt
gaaggtcttgaatatgagttccgtgtgaaatgtgaaaacctaggtggggaaagtgaatgg
agtgaaatatcagaacccatcactcccaaatctgatgtcccaattcaggcaccacacttt
aaagaggaactgagaaatctaaatgtcagatatcagagcaatgctactttggtctgcaaa
gtgactggtcatccaaaacctatcgtgaaatggtacagacaaggcaaagaaatcattgca
gatggattaaaatacaggattcaagaatttaagggtggctaccaccagctcatcattgca
agtgtcacagatgatgatgccacagtttaccaagtcagagctaccaaccaagggggatct
gtgtctggcactgcctccttggaagtggaagttccagctaagatacacttacctaaaact
cttgaaggcatgggagcagttcatgctctccgaggtgaagtggtcagcatcaagattcct
ttcagtggcaaaccagatcctgtgatcacctggcagaaaggacaagatctcattgacaat
aatggccactaccaagttattgtcacaagatccttcacatcacttgttttccccaatggg
gtacagagaaaagatgctggtttctatgtggtctgtgctaaaaacagatttggaattgat
cagaagacagttgaactggatgtggctgatgttcctgacccacccagaggagtcaaagtt
agtgatgtctcacgagattctgtcaacttaacatggactgagccggcctctgatggtggc
agcaaaatcaccaactacattgttgaaaaatgtgcaactactgcagaaagatggcttcgt
gtaggacaagcccgagaaacacgttatactgtgatcaacttatttggaaaaacaagttac
cagttccgggtaatagctgaaaataaatttggtctgagcaagccttctgagccttcagaa
ccaaccataaccaaagaagataagaccagagctatgaactatgatgaagaggtagatgaa
accagggaagtctccatgactaaagcatctcactcttcaaccaaggaactctatgagaaa
tatatgattgctgaagatcttgggcgtggtgagtttggaattgtccaccgttgtgttgaa
acatcctcaaagaagacatacatggccaaatttgttaaagtcaaagggactgatcaggtt
ttggtaaagaaggaaatttccattctgaatattgctaggcatagaaacatcttatacctc
catgaatcatttgaaagcatggaagaattagttatgatctttgagtttatatcaggactt
gacatatttgagcgcattaacacaagtgcttttgaacttaatgaaagagaaattgtaagt
tatgttcaccaggtctgtgaagcacttcagttcttacacagtcataatattggacacttt
gacattagaccagaaaatatcatttaccaaaccagaagaagctctaccattaaaataata
gaatttggtcaagcccgtcagctgaaaccaggtgacaacttcaggcttctattcactgcc
ccagaatactatgcacctgaagtccaccagcatgatgttgtcagcacagccacagacatg
tggtcacttggaacattggtatatgtgctattgagtggtatcaacccattcctggctgaa
actaaccaacaggtcattgagaatatcatgaatgctgaatatactttcgatgaagaagca
ttcaaagagattagccttgaagccatggattttgttgaccggttgttagtgaaagagagg
aaatctcgcatgacagcatcagaggctctccagcacccatggttgaagcagaagatagaa
agagtcagtactaaagttatcagaacattaaaacaccggcgttattaccacaccctgatc
aagaaagacttcaacatggttgtgtcagcagcccggatctcctgtggtggtgcaattcga
tctcagaggggagtgagtgttgctaaagttaaagtagcatccattgaaattggcccagtt
tctgggcagataatgcatgcagttggtgaagaaggaggacacgtcaaatatgtatgcaaa
attgaaaattatgatcagtctacccaagtgacttggtacttcggcgtccgacagctggag
aacagtgagaaatatgaaatcacctatgaagatggagtggccatcctctatgtcaaagac
attaccaaatttgatgatggtacctaccgatgcaaagtagtcaatgactacggtgaagat
agttcttatgcagagctatttgttaaaggtgtgagagaagtctatgactattactgccgt
agaaccatgaagaaaattaagcgcagaacagatacaatgagactcctggaaaggccacca
gaatttaccctgcccctctataataagacagcttatgtaggtgaaaatgtccggtttgga
gtaactataactgtccacccagagcctcgtgtaacatggtataaatcaggtcagaaaatc
aaaccaggtgacgatgacaagaagtacacatttgagtcagacaagggtctttaccaatta
acaatcaacagtgtcactacagatgatgacgctgaatatactgttgtggcaaggaacaaa
tacggtgaagacagctgtaaagcaaagctgacggtaaccctacacccacctccaacagac
agtaccttaagacccatgttcaaaaggttactggcaaatgcagaatgccaagaaggccaa
agtgtctgctttgagatcagagtgtctggcatccccccaccaacattaaaatgggagaaa
gatggtcagccactgtcccttggacctaacattgaaattatccatgaaggcttggattat
tatgctctgcacatcagggacactttgcctgaagacacaggttattatagagtcacagca
actaacacagctgggtccaccagctgccaggctcacctacaagtggaacgcctgaggtac
aagaaacaggaattcaagagtagagaggagcatgagcgacatgtacaaaaacaaattgac
aaaaccctcagaatggctgaaattctttctggaactgaaagtgtgccactgacacaggta
gctaaagaggctctgagagaagctgccatcctttacaaaccggctgtaagcaccaagact
gtaaaaggggaattcagacttgagacagaagaaaagaaagaggagagaaaactccggatg
ccttatgatgtaccagagccacgcaagtacaagcagactaccatagaagaagaccaacgc
atcaagcagtttgtgcccatgtctgacatgaagtggtataaaaagatacgtgatcagtat
gaaatgcctgggaaacttgacagagttgtacagaaacgacccaagcgcatccgcctctca
agatgggaacagttctatgtgatgcctcttccacgcattacggatcaatacagacctaaa
tggcgtattcctaaactgtcccaagatgatcttgagatagtgagaccagcccgccgacgt
acaccttctcctgattatgacttttactaccgacctagaagacgttctcttggagacatc
tctgatgaagaattacttctccccattgatgactacttagcaatgaaaagaacagaggaa
gagaggctgcgtcttgaagaagagcttgagttaggtttttcagcttcacccccaagccga
agccctccacactttgagctttctagcctacgatactcttcaccacaagctcatgtcaag
gtggaggaaacaagaaaagacttcaggtattcaacctatcacatcccaacgaaggctgaa
gttagtacaagttatgcagaactgagggaacggcatgcccaggctgcgtacagacagcca
aagcaacggcaaagaatcatggctgagaaggaggatgaagagttgcttcgcccagtttcg
accacccagcatctctcagaatacaaaagcgaacttgactacatgtcaaaggaggaaaag
tctagaaagaaatcaaggcgacaaagagaagtgacagaaataacagaaattgaggaagaa
tacgaaatctcaaaacgtgctcaaagagaatcatcctcatccgcatctagactactgaga
cgacggcgctccctgtctccaacttatattgagttaatgaggccggtgtctgagctgatc
cggtcacgtccactaccggctgaggaatacgaagatgacacagaaagaaggtcacctact
ccagaaagaactcgcccacgatcccccagccctgtgtctagtgagagatcactctcgaga
tttgagaggtctgcaagatttgatatcttttccaggtatgagtccatgaaagctgcttta
aaaactcagaagacatcagaaaggaagtatgaagttttgagtcagcagcctttcacactg
gaccacgcccctcgaatcacattgagaatgcgctcacacagggtaccatgtggccaaaat
acacgttttattttaaatgttcagtctaagccaactgctgaggttaaatggtaccacaat
ggtgtggaactccaagaaagcagtaagattcattacaccaacatgagtggagttctgacc
ctggaaattctggactgtcatattgatgacagtggaacctaccgtgctgtgtgcaccaac
tacaagggcgaagcttctgactatgcaacactggacgtaacaggaggggattataccacc
tatgcttccaggcgcagagatgaagaggtccccagatctgttttccctgagctgacaaga
acagaggcgtatgctgtttcatcatttaagaaaacatctgagatggaagcttcatcttct
gttagggaagtgaaatcacagatgacggagacaagggaaagtctctcctcatatgaacac
tatgcatctgcagaaatgaaaagtgctgcattagaagaaaagtcgctggaagaaaaatcc
acaaccacaaagatcaagacgactttggcggcaagaattctaacaaagccacggtccatg
actgtctacgagggcgagtctgcaaggttttcttgtgacaccgatggtgagccggtacca
actatgacctggctgcgtaaaggacaagtgctaagtacttctgcccgccaccaagtgacc
actacaaagtacaaatcaacctttgagatctcttcagttcaggcttccgatgagggcaat
tacagcgtggtggtagaaaacagtgaagggaaacaagaagcagagttcactctgactgtt
caaaaggccagggtaactgaaaaggctgtgacatcaccaccaagagtcaaatccccagag
tctcgggtgaaatccccagaagcagttaagtctccaaaacgagtgaaatctccagaacct
tctcaccccaaagccgtatcaaccacagagacaaaaccaacatcaacagagaaagttcag
catctcccagtctctgccccaccaaagattactcagttcctgaaagcagaagcttctaaa
gagattgcaaagctgacctgtgtggttgaaagcagtgtattaagtgcaaaagaggtcacc
tggtataaagatggcaagaaactgaaggaaaatgggcatttccagtttcattattcagca
gatggtacctatgagctcaaaatccataacctcactgaatctgatcaaggagaatatgtt
tgtgagatttctggtgaaggtggaacgtctaaaaccaacttccaatttatggggcaagcc
tttaagagtatccatgagaaggtatcaaaaatatcagaaactaagaaatcagatcagaaa
accactgagtcaacagaaaccaggaaaactgaaccaaaagctcctgaaccaatttcctca
aaaccagtaattgttactgggttgcacgatacaactgtttcttcagacagtgttgctaaa
tttgcagttaaggctactggagaaccccggccaactgtcatctggacaaaagatggaaag
gctattacacaaggaggtaaatataaactctctgaagacaagggagggttcctcttagaa
attcacaagactgatacttctgacagtggactttatacttgtacggtaaaaaattcagct
ggatctgtgtcctctagctgcaaattaacaataaaagctgtaaaagatactgaggcacag
aaagtctctacacaaaagacttctgaaattacatctcagaagaaagctgttgtccaagag
gaaatttcccaaaaagccctaatgtctgaagaaattaagatgtcagaggcaaaatctcaa
gaaaagttagccctcaaagaggaagcttcaaaggttttgatttccgaagaagtcaagaaa
gcagcagcaacctccctggaaaaatccgttgtccatgaggaaatcactaaaacatcacag
gcatcagaagaaatcagaactcatgctgagattaaagcattttctactcagatgagcata
aatgaaggtcaaagagtggttttaaaagccaacattgctggtgccactgatgtgaaatgg
gtactgaatggcatagagcttaccaactctgaggagtaccgatatggtgtctcaggcagc
gatcagaccctcaccatcaagcaagctagtcacagagatgaaggaatcctcacctgcata
ggcaaaaccaaggaaggaatcgtcaagtgtcaatatgatttgatgctgagcaaagaactc
tcagatgcaccagccttcatctcacagcctagatctcaaaatattaatgaaggacaaaat
gttctctttacttgtgaaatcagtggtgagccgtcccctgaaatcgaatggtttaaaaac
aacctgccaatttctgtttcttcaaatgtcagcataagtcgctccagaaacatatactct
cttgaaatccgaaatgcatcagtcagcgacagtggaaagtacacaattaaggccaaaaat
ttccgtggccagtgttcagctacagcctccttaatggtccttcctctagttgaagaacct
tccaaagaggtagtattgagaacaagtggtgacacaagcttgcaaggaagcttctcgtct
cagtcagtccaaatgtctgcctccaagcaggaggcctccttcagcagtttcagcagcagc
agtgctagcagcatgactgagatgaaatttgcaagcatgtctgcccaaagcatgtcctcc
atgcaagagtcctttgtagaaatgagttccagcagctttatgggaaaatctagtatgaca
caactggaaagttcaactagtaaaatgcttaaagcaggcataagaggaattccgcctaaa
attgaagctcttccatctgatatcagcattgatgaaggcaaagttctaacagtagcctgt
gctttcacgggtgagcctaccccagaagtaacatggtcctgtggtggaagaaaaattcac
aatcaagaacaacaggggaggttccacatagaaaacacagatgacctgacaaccctgatc
atcatggatgtacagaaacaagatggtggactttataccctgagtttagggaatgaattt
ggatctgactctgccactgtgaatatacatattcgatccatttaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677716
Entry
104677716         CDS       T03989                                 

Definition
(RefSeq) titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104677716
   05414 Dilated cardiomyopathy
    104677716
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104677716
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   104677716
Membrane trafficking [BR:rro04131]
 Others
  Actin-binding proteins
   Others
    104677716
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     104677716
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104677716
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig V-set C2-set_2
Other DBs
NCBI-GeneID: 104677716
NCBI-ProteinID: XP_010381165
LinkDB
Position
14
AA seq 2111 aa
MAAKRYASRISSTSSWPEYFKPSFTQKLMFKYVLEGEPVVFTCRLIACPSPEMTWFHNSR
PIPTGLRRIIKAKSDLHHHSSSLEIKRVQERDSGSYRLLAINSEGSAESTASLLVIQKGQ
DEKYLEFLKRAEQTHENVEALVERGEDRIKVDLRFTGSPFNKKQDMEQKGMVRTIHFKTM
SSAKKTDYMYDEEYLESKSDIRGWLNVGESFLDRETQVKLQRLREARKMLMEKKKLSLLD
TSSEISSRTLRREASDKDILFSREDMKIRSMSDLAESYKVNNSAESIVQNPHGLSNQMDQ
NIESEELPTSFQTIVDEEIFQTEIRMSPESLVKESLPKDHLYGEILVNENTQARGQLEEI
MASTTVGESPTYITNVCEKEEVCETPEKVSQAFTPHASESFGTLVNVEESEEIASERIRK
DDVRELQLSASTQIDESKTEQKEENMRFFENSFRKRPQRCPPSFLQEIESQEIYEGDSCN
FVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILTLLSVHHQNEGSITCVLFNQY
GTVKTTGMLKVKAKQKHDVKAHEVPVFHDYFDEEEELALVFDQAKGAHPSMSQEGQTNLH
VLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEEDKEMFQTEELEPEAMPQDQATQSPKH
KFVFLSDVTNEPPKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKF
QFEEVNCSHRLYIKDVNSQDSGKYKCLAENNSGTAESVSDLTVEPVTYRENGQFENIGEI
YGKYSRDQQVQVQGESVRARFYDYPAGPFTPWTNVKEYSVRDYFQSLETIKQIDQKDQVR
CIPSREKIPRFVRGASRTIKTNKPIRAEFIQCQAEGKEKHVSEKSKLHQAEGTVYPFVDD
FSDITIKKDVGNNFGKLGRSEKENVQEYAQSDYLPNIHSERISDSYNTKDSSAVAYEESL
GEEIHYPGKKVKHRITEFEKLHVEKRVLEKRPTRTSFVNPPQKKIDDKAFSLKQRESRSS
NLNANMCQAEKMSPNTESNSSNIAINLKLLSSQTHKESEAHERQQQEKISLIDKPAISKR
VEHESPITFDLKQFHTQIKHTDVKFQELDSSQPEEAYFKIQHPASVTADTENIVFDLKQM
YSHIGDPATEFQGQETREQQEIHYKEKIPSPETLQPDTQSISKNVQNNVFASQEISSSQE
LSYRTIVEKSSIDENSISLEKEVRHVQEQNLDILKTDLSLKSFSEEIYSESCALFPTSSA
DIEETDLSEKNSSLENGDRSFISHLKKAVSEEKPLEVGEMEEECTLEPEVASFPKQDGGA
EAYTDVTLEDHKGDIQEADILHRHLSLSQCFPFLMTEEKQNPGEQIITNIDASGEEKCYE
EVQVQNETSFSTLGEMIETSFSQNIPKLDEAHTTEVVESETSLAQYLLAAGKREVPETKD
TRDQAKLVQSESITSMEVEEVTFNTVYEYYNQKQESLGRPFSPESDISVGVGSTTSEEIS
ELDQFYTPPSSVEYFESPKSPDLYFNPSDVTKQSSIYSGGETVERYSTPLGEVAERYSTP
SEGEIGERYSTPPGETLERYSTPPGETLERYSTPPGETLERYSTPPGETLERYSTPPGEA
LERYSIPTGGPNPTGTFKTYPSKIEREDSTPNEHFYTPTEERGSADEIWRSDSFGTPNEA
IEPKDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPSVKWYRNKSLLEPDERIKMER
VGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMSQEERVVALPPPVTHQHVME
FDLENTTSSRTPSPQEIVLEVELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFN
FVDPNMDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAMFKCSVIGIPTPKVKW
YKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTLGDS
EILAMIAKKSKVTLSSLTEELVLKSNYTESFFEFQVVEGPPRFIKGISDCYAPIGTAAYF
QCLVRGSPRPTVYWYKDGKLVQGRRFSVEESGTGFHNLFITSLVKSDEGEYRCVATNKSG
VAETFAALTLT
NT seq 6336 nt   +upstreamnt  +downstreamnt
atggctgctaaaagatatgcaagtagaatatcatctacaagctcctggcctgaatatttt
aagccttcttttacccaaaaacttatgtttaaatatgttttagagggtgaaccagttgtt
tttacatgtagattaattgcctgtccatctccagaaatgacttggtttcataacagtcgg
cccattccaacaggtcttcgtcggattataaaagctaagagtgatttacaccatcactct
tccagcttagagattaaaagggtccaagagagagattctggaagttataggttactagca
attaatagtgaagggtctgctgaatcaactgcatcattgcttgttatccaaaaaggacaa
gatgagaaatatttagaatttctgaaaagagcagaacagacacatgaaaacgtggaggct
ttagttgaaaggggagaagacaggataaaggttgacctgaggtttactggctctcccttt
aacaaaaaacaagatatggagcaaaagggaatggtgagaactatacattttaagacaatg
agttctgccaagaaaacagattacatgtatgatgaagaatatttagaaagtaaatctgac
ataagaggatggcttaatgtaggtgaaagttttctggacagggagacccaagtgaagttg
caacgtttaagggaggctagaaaaatgttaatggagaaaaagaaattatctcttttagat
acgtcttctgaaataagctcaagaactttgagaagagaagctagtgataaagatattctg
ttctctagagaggacatgaaaatcagatctatgtctgatctagctgaaagttataaggta
aataattcagctgagagtattgtgcaaaatccacatggcctttctaatcaaatggatcaa
aatatagaatctgaggaacttcccacaagctttcaaactattgttgatgaagaaattttc
cagactgaaataagaatgagcccagagtcactggtaaaagaaagtctaccaaaagaccat
ttatatggtgaaattctagtaaatgaaaatacccaagcaagaggacagctggaagaaatt
atggccagtactacagttggagagtcacccacatatatcactaatgtatgtgagaaggag
gaagtatgtgagactcctgaaaaggtgtctcaagcttttacaccacatgccagcgaatct
tttggtacacttgtaaatgttgaagaaagtgaagaaatagctagtgaaagaataaggaag
gatgatgtaagagaattacaactctctgcttccacacaaatcgatgaatccaaaaccgaa
cagaaagaggaaaacatgagattttttgaaaattcttttcgaaaacgaccacaacgttgc
ccaccttcatttcttcaagaaattgaatctcaagaaatttatgaaggtgacagttgtaat
ttcgtgtgccattttcaaggatatcctcaacctatcgtgacgtggtataacaatgacatg
ccaatcccacgtaatcaaaactttatcattcattctttggaaaactattcaatattaact
cttctgtctgttcatcatcagaatgaaggttctattacttgtgtgctatttaaccaatat
ggaacagtaaaaacaaccggtatgcttaaagtgaaagcaaaacaaaaacatgatgtcaaa
gcacatgaagtcccagtgttccatgactactttgatgaggaagaagagctagcattggta
tttgatcaagcaaaaggcgcccacccatctatgagtcaagagggccaaacaaatcttcat
gtgttaaaaactaacccaccagtccctccctctggagatacagaattgctttcctttcct
gtagaaatccaggtaacagcagctacacctatcccagaagaggataaagagatgtttcaa
actgaagagctagaacctgaagcaatgcctcaagatcaagctactcagtcaccaaaacac
aaatttgtatttttgtctgatgttactaatgagccaccaaaaatgttacaagaaatgcca
aagcatgccaggtgtagagaaggggattccatcattcttgaatgtttaatatctggtgag
ccccagccagttgtaacatggtttcaaaatggagtccttttaaagcagaaccagaagttt
cagtttgaagaagttaactgtagccaccgattatatattaaagatgtgaattctcaagat
tctggaaaatataaatgtcttgctgaaaacaattcagggacagctgaaagtgtttcagat
ctaacagtggagcctgtcacttatagggagaatggtcaattcgaaaatattggtgaaatt
tatggaaaatattccagagatcagcaagtgcaagtccagggagaatctgtaagggcacgt
ttttatgattatccagctggtccttttactccctggacaaatgtaaaagaatattcagta
agggactattttcaaagccttgagaccattaagcagatagaccagaaagaccaggtgcgt
tgcataccttctagagaaaaaattcccagatttgtgcgtggtgcttcaagaaccataaaa
accaacaagcccatcagggctgaattcatacaatgtcaggctgaagggaaagagaaacat
gtaagtgaaaaatcaaagctgcaccaagcagagggtactgtttatccatttgttgatgat
ttcagtgatatcactattaagaaagacgtaggaaacaattttggaaaacttggtagatca
gaaaaggaaaatgtacaagaatatgcccaaagtgactatttaccaaatattcactctgag
agaatttctgacagttacaatacaaaagattcatctgccgttgcatatgaagaatccctt
ggtgaagagatacactacccggggaaaaaggtgaagcatagaattaccgaatttgaaaaa
ttacatgtagaaaaaagagttctagaaaaaagacctaccagaacatcatttgttaatcct
cctcaaaagaagattgatgacaaagccttttcattaaagcaaagagaatcaagatcaagt
aatctaaatgcaaatatgtgtcaggcagagaaaatgtctccaaatactgaatcaaattca
tctaacattgcaataaatttaaagctgctttcctctcaaactcataaggaatctgaagca
catgaaaggcaacaacaggaaaaaataagtcttatagataaacctgcaatttctaaaaga
gttgaacatgaatcacctattacatttgacttaaagcagtttcacactcaaataaaacac
acagatgtgaaattccaagaattagatagtagtcaaccagaagaagcttattttaaaatc
caacatcctgcttccgtaacagctgacactgagaacattgtgtttgatctaaaacaaatg
tattctcatataggagatccagctacggagtttcaagggcaagaaactagggaacagcag
gaaatacattataaagaaaaaattcctagccctgaaacattacaacctgatacacagagt
atctctaaaaatgtgcaaaataatgtatttgccagtcaagaaatttcttccagtcaggag
ctttcatatagaactatagtggagaaaagtagtattgatgaaaattccatttctttagaa
aaagaagtccgacatgtacaggaacaaaacttagacattttaaaaactgatctttctctt
aaatccttttctgaagaaatctatagtgaatcatgtgccctatttccaacctcatctgca
gatatagaagaaactgatctttctgagaaaaatagttctctagaaaatggagacagaagt
ttcatctcacatttgaaaaaagcagtaagtgaggaaaagcctttagaggttggtgaaatg
gaagaagaatgcactctagaaccagaggtggcatcatttccaaagcaggatggtggggca
gaggcatatacagatgtcactttggaagaccacaaaggtgatattcaggaggctgacata
ctccatagacacctctccctgagtcagtgcttcccattcttgatgactgaagaaaaacag
aatccaggtgaacaaataattacaaacattgatgcctctggagaagaaaaatgttatgaa
gaagtccaagttcaaaatgaaacttctttctccactttaggagaaatgatagaaactagt
ttttctcaaaatattcctaaattagatgaggcacataccactgaggtagtggaatctgag
acctccctagcacaatatttacttgctgctggaaagcgtgaggttcctgaaactaaagac
accagagaccaggcaaagcttgtccagagtgaatcaatcacttcaatggaggtggaagaa
gtaactttcaacactgtgtacgaatactacaaccagaaacaggaatcactaggtcgtcca
ttttctcctgagtctgacatttccgttggtgtgggaagtacaactagtgaagaaatatct
gagttagatcagttttataccccaccatcgtctgttgaatattttgaatctccaaagtcc
cctgacttatattttaatccttcagatgtaactaaacagtcctcaatatattcaggaggt
gagacagttgaaagatattccacacctttaggggaagttgctgaaagatattcaacacct
tccgaaggtgagataggagaaagatactccacacccccaggggagacactagagagatac
tccacacccccaggagagactctagagagatactccacacctccaggagagactctagag
agatactccacacccccaggagagactctagagagatattccacacccccaggggaggca
ctagagagatattctattcctactggaggaccaaaccccactggtacttttaaaacatat
ccatcaaaaatagaaagggaagacagtacaccaaatgagcatttctacacacctacagaa
gagagaggttcagctgacgaaatatggcgttccgattcatttggcacacccaatgaagcc
attgagccaaaagacaatgaaatgcctccatcttttattgaacctctgaccaaaaggaag
gtgtatgaaaacacaacactaggcttcattgttgaagttgaaggtcttccagttcctagt
gtgaagtggtatcgaaataaatctttactagagccagatgaaagaatcaaaatggaaagg
gtgggtaatgtgtgttcactggaaatttcaaacattcaaaaaggagaagggggagagtac
atgtgtcatgctgtaaacatcataggggaagcaaagagctttgcaaatgtagacataatg
tcccaagaagaaagagtggtggcactcccacctccagtaacacatcagcatgtcatggag
tttgatttggaaaacaccacatcatcaagaacaccttctcctcaagaaattgtcctggaa
gttgaattaagtgaaaaagacgttaaagaatttgagaagcaggtgaaaatagtgacagtt
cctgaatttactcctgaccataaaagtatgattgtgagtctagatgttcttccatttaat
tttgtagatccaaatatggattcaagggagggagaagacaaagaactaaaaattgattta
gaagtatttgaaatgcctcctcgctttataatgcctatttgtgattttaaaattccagaa
aattcagatgctatgttcaaatgttcagtcataggcatccctactcccaaagttaagtgg
tataaagaatatatgtgtattgagccagataacattaaatatgtgattagcgaggagaag
ggaagtcacactcttaaaattagaaatgtctgtctttctgatagtgcaacatacaggtgc
agagctgtgaattgtgtaggagaggctatctgtcggggattcctcaccttgggagattcc
gaaatacttgctatgatagcaaagaaaagcaaagtgactttaagcagtttgacagaagaa
ttggtcttaaagagcaattacacagaaagtttttttgaatttcaggtggtggaagggcct
cccaggtttatcaaaggtatttctgactgttatgcaccaataggtacagcagcatatttt
cagtgcttagttcgtggctctccaagacccacggtttactggtacaaagatgggaaattg
gtccaaggaagaaggttcagtgttgaggaaagtggcacagggttccacaacctgtttata
acaagcttagtaaagagtgatgaaggagagtacaggtgtgtagctacaaacaaatcagga
gtggctgagacctttgcagcactcaccttaacttaa

DBGET integrated database retrieval system