KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677590
Entry
104677590         CDS       T03989                                 

Gene name
FOS
Definition
(RefSeq) LOW QUALITY PROTEIN: proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04024  cAMP signaling pathway
rro04210  Apoptosis
rro04380  Osteoclast differentiation
rro04620  Toll-like receptor signaling pathway
rro04657  IL-17 signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04668  TNF signaling pathway
rro04713  Circadian entrainment
rro04725  Cholinergic synapse
rro04728  Dopaminergic synapse
rro04915  Estrogen signaling pathway
rro04917  Prolactin signaling pathway
rro04921  Oxytocin signaling pathway
rro04926  Relaxin signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro04932  Non-alcoholic fatty liver disease
rro04935  Growth hormone synthesis, secretion and action
rro05031  Amphetamine addiction
rro05132  Salmonella infection
rro05133  Pertussis
rro05135  Yersinia infection
rro05140  Leishmaniasis
rro05142  Chagas disease
rro05161  Hepatitis B
rro05162  Measles
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05224  Breast cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rro05323  Rheumatoid arthritis
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104677590 (FOS)
   04668 TNF signaling pathway
    104677590 (FOS)
   04024 cAMP signaling pathway
    104677590 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104677590 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104677590 (FOS)
   04660 T cell receptor signaling pathway
    104677590 (FOS)
   04658 Th1 and Th2 cell differentiation
    104677590 (FOS)
   04659 Th17 cell differentiation
    104677590 (FOS)
   04657 IL-17 signaling pathway
    104677590 (FOS)
   04662 B cell receptor signaling pathway
    104677590 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    104677590 (FOS)
   04917 Prolactin signaling pathway
    104677590 (FOS)
   04921 Oxytocin signaling pathway
    104677590 (FOS)
   04926 Relaxin signaling pathway
    104677590 (FOS)
   04935 Growth hormone synthesis, secretion and action
    104677590 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    104677590 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    104677590 (FOS)
   04728 Dopaminergic synapse
    104677590 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104677590 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104677590 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104677590 (FOS)
   05231 Choline metabolism in cancer
    104677590 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104677590 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104677590 (FOS)
   05224 Breast cancer
    104677590 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    104677590 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    104677590 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104677590 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104677590 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104677590 (FOS)
   05135 Yersinia infection
    104677590 (FOS)
   05133 Pertussis
    104677590 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104677590 (FOS)
   05170 Human immunodeficiency virus 1 infection
    104677590 (FOS)
   05161 Hepatitis B
    104677590 (FOS)
   05171 Coronavirus disease - COVID-19
    104677590 (FOS)
   05162 Measles
    104677590 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104677590 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    104677590 (FOS)
   05142 Chagas disease
    104677590 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104677590 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104677590 (FOS)
   04131 Membrane trafficking [BR:rro04131]
    104677590 (FOS)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    104677590 (FOS)
Membrane trafficking [BR:rro04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    104677590 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Other DBs
NCBI-GeneID: 104677590
NCBI-ProteinID: XP_010380972
UniProt: A0A2K6QKF1
LinkDB
Position
5
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPTPSAGAYSRAGIVKTMTGSRA
QSTGRRGKVEQLSPEEEEKRRIRREXNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEAATPESEEAFT
LPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctcgggcttcaacgcagactacgaggcgtcatcctcgcgctgcagcagcgcg
tccccggccggggatagcctctcctactaccactcacccgccgattccttctccagcatg
ggctcgcctgtcaacgcgcaggacttctgcacggacctggccgtctccagtgccaacttc
attcccacggtcactgccatctcgaccagtccggacctgcagtggcttgtgcagcccgcc
ctcgtctcctctgtggccccatcgcagaccagagcccctcaccccttcggagtccccact
ccctccgctggggcttactccagggctggcattgtgaagaccatgacaggaagccgagca
cagagcactggaaggaggggcaaggtggaacagttatctccagaagaagaagagaaaagg
agaatccgaagggaanagaataagatggctgcagccaaatgccgcaaccggaggagggag
ctgactgatacactccaagcggagacagaccaactagaagatgagaagtctgctttgcag
accgagattgccaacctgctgaaggagaaggaaaaactagaattcatcctggcagctcac
cgacctgcctgcaagatccctgatgacctgggcttcccagaagagatgtctgtggcttcc
cttgatctgactgggggcctgccagaggctgccaccccggagtctgaggaggccttcacc
ctgcctctcctcaatgacccggagcccaagccctcagtggagcctgtcaagagcatcagc
agcatggagctgaaggccgagccctttgatgacttcctgttcccagcatcatccaggccc
agcggctctgagacagcccgctccgtgccagacatggacctatctgggtccttctatgca
gcagactgggagcccctgcacagtggctccctggggatggggcccatggccacagagctg
gagcccctgtgcactccggtggtcacctgtactcccagctgcactgcttacacgtcttcc
ttcgtcttcacctatcctgaggctgactccttccccagctgcgcagctgcccaccgcaag
ggcagcagcagcaatgagccctcctctgactcgctcagctcacccacgctgctggccctg
tga

DBGET integrated database retrieval system