KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677649
Entry
104677649         CDS       T03989                                 

Gene name
NKX6-2
Definition
(RefSeq) homeobox protein Nkx-6.2
  KO
K09350  homeobox protein Nkx-6.2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104677649 (NKX6-2)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    104677649 (NKX6-2)
SSDB
Motif
Pfam: Homeodomain PKK Homez
Other DBs
NCBI-GeneID: 104677649
NCBI-ProteinID: XP_030796231
LinkDB
Position
11
AA seq 277 aa
MDTNRPGAFVLSSAPLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGI
SDILGRPVGAAGGGLLGGLPRLNGLASSAGVYFGPAAAVARGYPKPLAELPGRPPIFWPG
VVQGAPWRDPRLAGPAPASGVLDKDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERAR
LAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKKRQDSDAEKLKVGGSDAEDDDEYNR
PLDPNSDDEKITRLLKKHKPSNLALVSPCGGGAGDAL
NT seq 834 nt   +upstreamnt  +downstreamnt
atggacactaaccgcccgggcgcgttcgtgctgagcagtgccccgctggccgcgctgcac
aacatggccgagatgaagacgtcgctgttcccctacgcgctgcagggtccggccggcttc
aaggcgcccgcgctggggggcctgggcgcgcagctcccgctcgggaccccgcacggcatc
agcgacatcctgggccggcccgtgggcgcggcgggcggaggcctcctaggggggctgccc
cggctcaacgggctcgcctcgtccgccggcgtctacttcggacccgcggccgccgtggcg
cgcggctaccccaagcccctggccgagctgcccggccgcccgcccatcttctggcccggc
gtggtgcagggcgcgccctggagggacccgcgtctggccggcccggccccagccagcggc
gtcctggacaaggacgggaagaagaagcactcgcgcccgacgttctcgggccagcagatc
ttcgcgctggagaaaaccttcgagcaaaccaagtacctggcgggcccggagcgcgcgcgt
ctcgcctactcgctgggcatgaccgagagccaggtgaaggtctggttccagaaccgccgg
accaagtggcgcaagcggcacgcggcggagatggcgtcggccaagaagaggcaggactcc
gacgcggagaagctgaaggtgggcggctcggacgcggaggacgacgacgaatacaaccgg
cccctggaccccaactcggacgacgagaagatcacgcggctgctcaagaagcacaaaccc
tcgaacttggcgctggtcagcccgtgcggcggcggcgcgggggacgccttgtga

DBGET integrated database retrieval system