KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677696
Entry
104677696         CDS       T03989                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9 isoform X1
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01524  Platinum drug resistance
rro04115  p53 signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro04370  VEGF signaling pathway
rro04919  Thyroid hormone signaling pathway
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05014  Amyotrophic lateral sclerosis
rro05016  Huntington disease
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05134  Legionellosis
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05215  Prostate cancer
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    104677696 (CASP9)
   04151 PI3K-Akt signaling pathway
    104677696 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104677696 (CASP9)
   04215 Apoptosis - multiple species
    104677696 (CASP9)
   04115 p53 signaling pathway
    104677696 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    104677696 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104677696 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104677696 (CASP9)
   05212 Pancreatic cancer
    104677696 (CASP9)
   05215 Prostate cancer
    104677696 (CASP9)
   05213 Endometrial cancer
    104677696 (CASP9)
   05222 Small cell lung cancer
    104677696 (CASP9)
   05223 Non-small cell lung cancer
    104677696 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104677696 (CASP9)
   05012 Parkinson disease
    104677696 (CASP9)
   05014 Amyotrophic lateral sclerosis
    104677696 (CASP9)
   05016 Huntington disease
    104677696 (CASP9)
   05020 Prion disease
    104677696 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    104677696 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    104677696 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    104677696 (CASP9)
   05152 Tuberculosis
    104677696 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104677696 (CASP9)
   05161 Hepatitis B
    104677696 (CASP9)
   05160 Hepatitis C
    104677696 (CASP9)
   05164 Influenza A
    104677696 (CASP9)
   05162 Measles
    104677696 (CASP9)
   05168 Herpes simplex virus 1 infection
    104677696 (CASP9)
   05163 Human cytomegalovirus infection
    104677696 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104677696 (CASP9)
   05169 Epstein-Barr virus infection
    104677696 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104677696 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104677696 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104677696 (CASP9)
   01002 Peptidases and inhibitors [BR:rro01002]
    104677696 (CASP9)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     104677696 (CASP9)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104677696 (CASP9)
Peptidases and inhibitors [BR:rro01002]
 Cysteine peptidases
  Family C14: caspase family
   104677696 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 104677696
NCBI-ProteinID: XP_010381119
UniProt: A0A2K6R5R4
LinkDB
Position
12
AA seq 416 aa
MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFKPHMIEDIQRAGSGSRRDQARQLIT
DLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAVQLSKPTLENLTPVVLRPEIRKPEV
LRPETPRPVDIGSGGFGDVGAPESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLSTR
TGSSIDCEKLQRRFSSLHFMVEVKHDLTAKEMVLALLELARRDHSALDCCVVVILSHGCQ
ASHLQFPGAVYGTDGCPVSVERIVNIFNGTSCPSLGGKPKLFFIQACGGDQKDHGFEVAS
TPPEDVSSGSNPEPDATPFQDDLRTFDQLDAVSSLPTPSDIFVSYSTFPGFVSLRDPKSG
SWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggatgaagcggaccggcggctcctgcggcggtgccggctgcggctggtggaggagctg
caggtggaccagctctgggacgccctgctgagccgcgagctgttcaagccccacatgatc
gaggacatacagcgggcaggctctggatctcggcgggatcaggccaggcaactgatcaca
gatctagagactcgagggagtcaagctcttcctttgttcatctcctgcttagaggataca
ggccaggacatgttggcttcattcctgcgaactaacaggcaagcagtacagttgtcgaag
ccaaccctagaaaaccttaccccagtggtgctcagaccagagattcgcaaaccagaagtt
ctcagaccggaaacacccagaccagtggacattggttctggaggattcggtgatgtcggt
gctcctgagagtttgaggggaaatgcagatttggcttacatcctgagcatggagccctgt
ggccactgcctcattatcaacaatgtgaacttctgccgtgagtctgggctcagcacccgc
actggctccagcatcgactgtgagaagttgcagcgccgcttctcctcgctgcatttcatg
gtggaggtgaagcacgacctgactgccaaggaaatggtgctagctttgctggagctggca
cggcgggaccacagtgctctggactgctgtgtggtggtcattctctctcacggctgtcag
gccagccacctgcagtttccaggggctgtctatggcacagatggatgccctgtgtcggtc
gagaggattgtgaacatcttcaatgggaccagctgccccagcctgggagggaagcccaag
ctctttttcatccaggcctgtggtggggatcagaaagaccatgggtttgaggtggcctcc
accccccctgaagacgtgtcctctggcagtaaccccgagccagacgccaccccgttccag
gacgatttgaggaccttcgaccagctggacgctgtatctagtttgcccacacccagcgac
atctttgtgtcctactctactttcccgggttttgtctccttgagggaccccaagagtggc
tcctggtacgttgagaccctggacgacatctttgagcagtgggctcactctgaagacctg
cagtccctcctgctcagggtcgctaatgctgtttcggtgaaagggatttataaacagatg
cctggttgctttaatttcctccggaaaaaacttttctttaaaacatcataa

DBGET integrated database retrieval system