KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677708Help
Entry
104677708         CDS       T03989                                 

Gene name
OGDHL
Definition
(RefSeq) oxoglutarate dehydrogenase-like
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00020  Citrate cycle (TCA cycle)
rro00310  Lysine degradation
rro00380  Tryptophan metabolism
rro01100  Metabolic pathways
rro01200  Carbon metabolism
Module
rro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rro_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rro_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104677708 (OGDHL)
  09105 Amino acid metabolism
   00310 Lysine degradation
    104677708 (OGDHL)
   00380 Tryptophan metabolism
    104677708 (OGDHL)
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     104677708 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 104677708
NCBI-ProteinID: XP_010381139
UniProt: A0A2K6Q2S5
LinkDB All DBs
Position
Un
AA seq 1010 aa AA seqDB search
MNQLRLLPSRLGAQAARLLAAHEVPVFGWRSRSSGPPATFPSSKGGGSSSYMEEMYFAWL
ENPRSVHKSWDNFFRKASEEASSGSAQPRPPSVVRESRSAVSSRTKTSKLVEDHLAVQSL
IRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLAFYDLQEADLDKEFQLPTTTF
IGGSENTLSLREIIRRLENTYCQHIGLEFMFINDVEQCQWIRQKFETPGVMQFSSEEKRT
LLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIENVILGMPHRG
RLNVLANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTNRNITLSLVAN
PSHLEAVDPVVQGKTKAEQFYRGDAQGKKVMSILVHGDAAFAGQGVVYETFHLSDLPSYT
TNGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAEW
RNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHRQVPVLKKYADKLIAEGTVTLQ
EFEEEIAKYDRICEEAYGRSKDKKILHIKHWLDSPWPGFFNVDGEPKSMTCPATGIPEDV
LTHIGSVASSVPLEDFKIHTGLSRILRGRADMTNNRTVDWALAEYMAFGSLLKEGIHVRL
SGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGYA
MASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSSA
RPERFLQMSNDDSDAYPAFTKDFEVSQLYDCNWIVVNCSTPANYFHVLRRQILLPFRKPL
IIFTPKSLLRHPEAKSSFDQMVSGTSFQRVIPEDGAAARAPEQVQRLIFCTGKVYYDLVK
ERSSQGLEEKVAITRLEQISPFPFDLIKQEAEKYPDAELAWCQEEHKNMGYYDYISPRFM
TILRRTRPIWYVGRDPAAAPATGNRNTHLVSLKKFLDTAFNLQAFEGKTF
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagctgaggctgttgccgtcccgtcttggggcacaggctgcgaggcttctggcc
gcacatgaagtcccagtgtttggctggcgcagcaggtcctctgggccaccggccaccttc
ccaagcagcaaaggtggaggcagctccagttacatggaggagatgtacttcgcctggttg
gaaaacccccggagtgtccacaagtcctgggacaacttcttccggaaagccagtgaggaa
gcctcttctggctctgctcagccacggcccccttctgttgtccgtgagagcaggtctgca
gtctcaagccggaccaagaccagcaagttagtggaggaccacctggccgtgcagtccctg
atccgggcctaccagatccgtggtcaccatgtggcccagctggaccccttgggcattctg
gatgcagacctggactcctttgtgccctcagacttgatcacaaccattgataaactggcc
ttctatgacctgcaggaggctgaccttgataaggagttccagctgccgacgaccaccttc
atcgggggctctgaaaacaccctctctctgcgggagatcattcgacgcctggagaacact
tactgccagcacattggcctggagttcatgttcatcaatgatgtggagcagtgccagtgg
atccggcagaagtttgagacccctggtgtgatgcagttctccagcgaggagaagcggaca
ctgctggcccggctggtgcgctccatgaggtttgaagacttcctggcccggaagtggtcc
tcagagaagcggtttggcctggagggctgtgaagtgatgattcctgccctcaagaccatc
atcgacaaatccagcgagatggggatcgagaatgtcatcttggggatgccacacaggggc
aggctgaacgtgctggccaacgtgatccgcaaggacctggagcagatcttctgccagttt
gaccccaagctggaggcggcagacgagggctccggggacgtcaagtaccacctgggcatg
taccatgagaggatcaaccgtgtcaccaaccggaacatcactctgtcgctggtcgccaac
ccctcccacctggaggcagtggaccctgtggtgcaggggaagacaaaggcagagcagttc
taccgtggagacgcccagggcaagaaggtcatgtccatcctggttcatggggatgctgcc
tttgccggccagggtgtggtatatgagaccttccacctgagcgacctgccctcctacaca
accaacggtaccgtgcacgtcgtcgtcaacaaccagattggattcaccacagacccccga
atggcccgttcctcaccataccccaccgacgtggcccgggtggtcaatgcgcccatcttc
cacgtgaacgccgatgacccagaggctgtgatatatgtgtgcagtgtggcagccgaatgg
agaaacactttcaacaaagacgttgtcgtagacctggtctgttaccgccggcgcggccac
aatgagatggacgagcccatgttcacccagccactcatgtacaagcagatccacagacag
gtgcctgtgctgaagaagtacgcagacaagctgattgccgagggcacggtcaccctgcag
gagtttgaggaagaaattgcgaaatacgaccggatctgtgaggaggcttatggcaggtcc
aaggataaaaagatcctgcatataaagcactggttggactccccctggcccggcttcttc
aacgtagatggggagcccaagagcatgacatgcccagccacagggatccctgaggacgtg
ctcacccacattggcagcgtggccagctctgtgcccctggaggactttaagatccacacc
ggcctctctcgcattctgcggggccgtgcggacatgaccaataaccggacagtggactgg
gcgttggcagagtacatggcctttggctccttgctgaaagagggcatccacgtgcggctc
agcgggcaggatgtggagaggggcacattcagtcaccggcaccacgttctccatgaccag
gaggttgaccgcaggacgtgtgtgcctatgaatcatctctggcctgaccaggccccgtac
accgtgtgcaacagctccctctcggagtacggagtcctgggctttgagctgggctatgcc
atggccagccccaatgccctggtcctctgggaggcccagtttggggacttccacaacacg
gcccagtgcatcatcgaccagttcatcagcaccggccaggccaagtgggtgcggcataac
ggcattgtgctgctgctgccccatggcatggaaggcatgggcccagagcactcgtctgcg
aggcccgagaggttcctgcagatgagcaatgatgactccgatgcctaccccgcattcacc
aaggacttcgaggtgagtcagctctatgactgcaactggatcgtggtcaactgctccaca
ccggccaactacttccacgtgctgcgccggcagatcctgctgcccttccgcaagccgctg
attatcttcacacctaaatctctgctgaggcacccagaggccaagtccagctttgaccaa
atggtatccgggaccagcttccagcgggtgattcctgaagatggggctgcagcgcgggcc
cctgagcaggtgcagcggctcatcttctgcacgggaaaggtgtactatgacctggtgaag
gagcggagcagccagggcctggaggagaaggtggccatcacgcgcctggagcagatctct
ccattcccctttgacctgatcaagcaagaggcagagaagtacccagatgcggagctggcc
tggtgtcaggaggagcacaagaacatgggctactatgactacatcagcccacgcttcatg
accatcctgaggcgcacgcggcccatatggtatgtcggccgggacccagcggctgcacca
gccacaggaaacaggaacactcacctggtgtcactgaagaagtttctggatactgccttc
aatctccaggcctttgagggcaagacattttag

DBGET integrated database retrieval system