KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104678338
Entry
104678338         CDS       T03989                                 

Gene name
SGCB
Definition
(RefSeq) beta-sarcoglycan
  KO
K12566  beta-sarcoglycan
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104678338 (SGCB)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104678338 (SGCB)
   05414 Dilated cardiomyopathy
    104678338 (SGCB)
   05416 Viral myocarditis
    104678338 (SGCB)
SSDB
Motif
Pfam: Sarcoglycan_1
Other DBs
NCBI-GeneID: 104678338
NCBI-ProteinID: XP_010381887
UniProt: A0A2K6QSX8
LinkDB
Position
2
AA seq 318 aa
MAAAAAAAAEQQSSNGPVKKSMREKAVERRNVNKEHNSNFKAGYIPIDEDRLHKTGLRGR
KGNLAICVIILLFILAVINLIITLVIWAVIRIGPNGCDSMEFHESGLLRFKQVSDMGVIH
PLYKSTVGGRRNENLVITGNNQPIVFQQGTTKLSVENNKTSITSDIGMQFFDPRTQNILF
STDYETHEFHLPSGVKSLNVQKASTERITSNATSDLNIKVDGHAIVRGNEGVFIMGKTIE
FHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGDQLGSGDWVRYKLCMCADGTLFKVQV
TSQNMGCQISDNPCGNTH
NT seq 957 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggctgccgagcagcaaagttccaatggtcctgtaaagaag
tccatgcgtgagaaggctgttgagagaaggaatgtcaataaggagcacaacagtaacttt
aaagctggatacattccgattgatgaagatcgtctccacaaaacagggttgagaggaaga
aagggcaatttagccatctgtgtgattatcctcttgtttatcctggctgtcatcaattta
attataacacttgttatttgggctgtgattcgcattggaccaaatggctgtgatagtatg
gagtttcatgaaagtggcctgcttcgatttaagcaagtatctgacatgggagtgatccat
cctctttataaaagcacagtaggaggaaggcgaaatgaaaatttggtcatcactggcaac
aaccagcctattgtttttcagcaagggacaacaaagctcagtgtagaaaataacaaaact
tctatcacgagtgacatcggcatgcagttttttgacccgaggactcaaaatatcttattc
agcacagactatgaaactcatgagtttcatttgccaagtggagtgaaaagtttgaatgtt
caaaaagcatctactgaaaggattaccagcaatgctaccagtgatttaaatataaaagtt
gatgggcatgctattgtgcgtggaaatgaaggagtattcattatgggcaaaaccattgaa
tttcacatgggtggtaatatggagttaaaggcggaaaacagtatcatcctaaatggatct
gtgatggtcagcaccacccgcctacccagttcctccagtggagaccagttgggtagtggt
gactgggtgcgatacaagctctgcatgtgtgctgatgggacactcttcaaggtgcaagta
accagccagaacatgggctgccaaatatcagacaacccctgtggaaacactcattag

DBGET integrated database retrieval system