KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104678435
Entry
104678435         CDS       T03989                                 

Gene name
MAX
Definition
(RefSeq) protein max isoform X1
  KO
K04453  Max protein
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104678435 (MAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104678435 (MAX)
   05202 Transcriptional misregulation in cancer
    104678435 (MAX)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104678435 (MAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104678435 (MAX)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    104678435 (MAX)
SSDB
Motif
Pfam: HLH DUF5716 Jnk-SapK_ap_N Filament bZIP_2 SlyX DUF5595 ZapB DUF4763 TFIIA Csm1_N ATG16
Other DBs
NCBI-GeneID: 104678435
NCBI-ProteinID: XP_010382013
LinkDB
Position
5
AA seq 167 aa
MLSVKITSIFSIFFSLLFQEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSL
QGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQT
NYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
NT seq 504 nt   +upstreamnt  +downstreamnt
atgttaagtgtaaaaataacttctatattttctatttttttttctctcctattccaggaa
gagcaaccgaggtttcaatctgcggctgacaaacgggctcatcataatgcactggaacga
aaacgtagggaccacatcaaagacagctttcacagtttgcgggactcagtcccatcactc
caaggagagaaggcatcccgggcccaaatcctagacaaagccacagagtatatccagtat
atgcgaaggaaaaaccacacacaccagcaagatattgacgacctcaagcggcagaatgct
cttctggagcagcaagtccgtgcactggagaaggcgaggtcaagtgcccaactgcagacc
aactacccctcctcagacaacagcctctacaccaacgccaagggcagcaccatctctgcc
ttcgatgggggctcagactccagctcggagtctgagcctgaagagccccaaagcaggaag
aagctccggatggaggccagctaa

DBGET integrated database retrieval system