KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104678783
Entry
104678783         CDS       T03989                                 

Gene name
P2RY4
Definition
(RefSeq) P2Y purinoceptor 4
  KO
K04271  P2Y purinoceptor 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04080  Neuroactive ligand-receptor interaction
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104678783 (P2RY4)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104678783 (P2RY4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104678783 (P2RY4)
G protein-coupled receptors [BR:rro04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    104678783 (P2RY4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 104678783
NCBI-ProteinID: XP_010382436
UniProt: A0A2K6NAY3
LinkDB
Position
7
AA seq 365 aa
MASTESSLLRSIGLSPGPGSSEVELDCWFDEDFKFILLPVSYAVVFVLGLGLNAPTLWLF
IFRLRPWDATATYMFHLALSDTLYVLSLPTLIYYYAARNHWPFGTEICKFVRFLFYWNLY
CSVLFLTCISVHRYLGICHPLRALRWGRPRLAGLICLTVWLVVAGCLVPNLFFVTTSTKG
TTVLCHDTTRPEEFDHYVHFSSAVMGLLFGVPCLVTLVCYGLMARRLYQPLPGAAQSSSR
LRSLRTIAVVLTVFAVCFVPFHITRTIYYLARLLEADCRVLNIVNVVYKVTRPLASANSC
LDPVLYLLTGDKYRRQLHQLCGGGKPQPRTAASSLALVSLPENSSCRWAATPQDSSFSTP
RADRL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggccagtacagagtcctcgctgttgagatccatcggcctcagcccaggtcctggcagc
agtgaggtggagctggactgttggtttgatgaggatttcaagttcatcctgcttcctgtg
agctatgcagttgtctttgtgctgggcttgggccttaacgccccaaccctatggctcttc
atcttccgcctccgaccctgggatgcaactgccacctacatgttccacctggcgttgtca
gacaccttgtatgtgctgtcgctgcccaccctcatctactattatgcagcccgcaaccac
tggccctttggcactgagatctgcaagttcgtccgctttcttttctattggaacctctac
tgcagcgtccttttcctcacctgcattagcgtgcaccgctacctgggcatctgccaccca
cttcgggcactacgctggggccgccctcgcctcgcaggccttatctgcctgacagtttgg
ttggtcgtagccggctgcctcgtgcccaacctgttcttcgtcacaaccagcaccaaaggg
accactgtcctgtgccatgacaccactcggcctgaagagtttgaccactatgtgcacttc
agctcggcggtcatggggctgctctttggcgtgccctgcctggtcactcttgtttgctat
gggctcatggcccgtcgcctgtatcagcccttgccaggcgctgcacagtcttcttctcgt
ctccgatctctccgcaccatagctgtggtgctgactgtcttcgctgtctgctttgtgcct
ttccacatcacccgcaccatttactacctggcaaggctgttggaagctgactgccgagtg
ctgaacattgtcaacgtggtctataaagtgactcggcccctggccagtgccaacagctgc
ctggatcctgtgctctacttgctcactggggacaaatatcgacgtcagctccatcagctc
tgtggtggtggcaagccccagccccgcacggctgcctcttccctggccctagtgtccctg
cctgagaatagcagctgcaggtgggcagccaccccccaggacagtagcttctctactcct
agggcagatagattgtaa

DBGET integrated database retrieval system