KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104678915Help
Entry
104678915         CDS       T03989                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00010  Glycolysis / Gluconeogenesis
rro00030  Pentose phosphate pathway
rro00051  Fructose and mannose metabolism
rro00052  Galactose metabolism
rro01100  Metabolic pathways
rro01200  Carbon metabolism
rro01230  Biosynthesis of amino acids
rro03018  RNA degradation
rro04152  AMPK signaling pathway
rro05230  Central carbon metabolism in cancer
Module
rro_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104678915 (PFKP)
   00030 Pentose phosphate pathway
    104678915 (PFKP)
   00051 Fructose and mannose metabolism
    104678915 (PFKP)
   00052 Galactose metabolism
    104678915 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    104678915 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    104678915 (PFKP)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    104678915 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104678915 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rro03019]
    104678915 (PFKP)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     104678915 (PFKP)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104678915 (PFKP)
Messenger RNA biogenesis [BR:rro03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     104678915 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 104678915
NCBI-ProteinID: XP_010382626
UniProt: A0A2K6PT80
LinkDB All DBs
Position
Un
AA seq 746 aa AA seqDB search
MNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDGGANIAEADWESVSSILQVGGTIIGSARC
QAFRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANLFRKEWSGLLEELARNGQIDKEA
VQKYAYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVIDAIMTTAQSHQRTFVLEVMG
RHCGYLALVSALACGADWVFLPESPPEDGWEEQMCVKLSENRARKKRLNIIIVAEGAIDT
QNKPITSEKIKELVVTQLGYDTRVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATP
DTPACVVSLNGNHAVRLPLMECVQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLA
IKLPDDQIPKTNCNVAVINVGAPAAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQI
KEIGWTDVGGWTGQGGSILGTKRVLPGKYLEEIARQMRAHSINALLIIGGFEAYLGLLEL
SAAREKHEEFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVF
IIETMGGYCGYLANMGGLAAGADAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRN
ESCSENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWIT
AKLKEARGRGKKFTTDDSVCVLGISKRNVIFQPVAELKKQTDFEHRIPKEQWWLKLRPLM
KILAKYKASYDVSDSGQLEHVQPWSV
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctgccgtccgtgctgtggtgcgtatgggcatctacgtgggggccaaggtgtac
ttcatctatgagggctaccagggcatggtggacggaggtgcgaacatcgcggaggccgac
tgggagagcgtctccagcatcctgcaagtgggcgggacgatcattggcagtgcgcggtgc
caggccttccgcacgcgggaaggccgcctgaaggccgcctgcaacctgctgcagcgtggc
atcaccaacctgtgtgtgatcggcggggacgggagcctcaccggggccaacctcttccgg
aaggagtggagcgggctgctggaggagctggccaggaatggccagatcgataaggaggcc
gtgcagaagtacgcctacctcaacgtggtgggcatggtgggctccattgacaatgatttc
tgcggcaccgacatgaccatcggcactgactccgccctgcataggatcatcgaggtcatt
gacgccatcatgaccacggcccagagccaccagaggaccttcgttctggaggtgatggga
cgacactgtgggtacctggccctggtgagcgccttggcctgcggtgcagactgggtgttc
cttccggaatctccgccagaggacggctgggaggagcagatgtgtgtcaaactctcggag
aaccgagcccggaaaaaaaggctgaatattattattgtggctgaaggagcaattgatacc
caaaataaacccattacctctgagaaaatcaaagagctcgtcgtcacgcagctgggctac
gacacacgtgtgaccatccttgggcacgtgcagagaggagggaccccttcggcattcgac
aggatcttggccagccgcatgggagtggaggcggtcatcgccttgctagaggccaccccg
gacaccccagcttgcgtcgtgtcgctgaacgggaatcacgctgtgcgcctgccactgatg
gagtgcgtgcagatgactcaggatgtgcagaaggcgatggacgagaggagatttcaagat
gcggttcggctccgagggaggagctttgcgggcaacctgaacacctacaagcgacttgcc
atcaagctgccggacgatcagatcccaaagaccaattgcaacgtggctgtcatcaacgtg
ggggcgcccgcggccgggatgaacgcggccgtgcgctcagctgtgcgcgtgggcattgct
gacggccacaggatgctcgctatctacgatggctttgatggcttcgccaagggccagatc
aaagaaatcggctggacagatgtcgggggctggaccggccaaggaggctccatccttggg
acaaaacgcgttctcccgggaaagtacctggaggagatcgccaggcagatgcgcgcgcac
agcatcaacgcgctactgatcatcggcgggtttgaggcctacctgggactcctggagctg
tcagccgcccgggagaagcacgaggagttctgtgtgcccatggtcatggttcccgctact
gtgtccaacaatgtgccgggttccgatttcagcattggggcagacacagccctgaacact
atcaccgacacctgtgaccgcatcaagcagtctgccagcggaaccaagcggcgcgtgttc
atcatcgagaccatgggcggctactgtggctacctggccaacatggggggcctcgcggcc
ggagccgatgctgcatacattttcgaagagcccttcgacatcagggatctgcagtccaat
gtggagcacctgacagagaaaatgaagaccaccatccagaggggccttgtgctcagaaat
gagagctgcagtgaaaactacaccaccgacttcatttaccagctctattcggaagagggc
aaaggcgtgtttgactgcaggaagaacgtgctgggccacatgcagcagggtggggcaccc
tctccatttgatagaaactttggaaccaaaatctctgccagagctatggagtggatcact
gcgaaactcaaggaggcccggggcagaggaaaaaaatttaccactgatgattccgtttgt
gtgttgggaataagcaaaagaaacgttatttttcaacctgtggcagaactgaaaaagcaa
acggattttgagcacaggattcccaaagaacagtggtggctcaagctgcggcccctcatg
aaaatcctggccaagtacaaggccagctacgacgtgtcagactcaggccagctagagcac
gtgcaaccatggagcgtctga

DBGET integrated database retrieval system