KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104678937Help
Entry
104678937         CDS       T03989                                 

Gene name
NSD2, WHSC1
Definition
(RefSeq) nuclear receptor binding SET domain protein 2
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00310  Lysine degradation
rro05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    104678937 (NSD2)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    104678937 (NSD2)
Enzymes [BR:rro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104678937 (NSD2)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104678937 (NSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET PHD HMG_box HMG_box_2 zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 104678937
NCBI-ProteinID: XP_010382659
UniProt: A0A2K6PTK0
LinkDB All DBs
Position
Un
AA seq 1365 aa AA seqDB search
MEFSIKQSPLSVQSVVKCVKMKQAPEILSSANGKAPSCEVNRECSVFLSKAQLSSTLQEG
VMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNG
SPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENAQKPENKARRNRKRSIKYDSLLE
QGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMV
SADPLLHSYTKLKGQKKSARQYHVQFFGDAPERAWIFEKSLVAFEGEGQFEKLCQESAKQ
APTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVA
KEAGIAAESFGEMAESSGVGEEAAENPKSAREEGIPMKRRRRAKLCSSAETRESDPDVVK
STPQKTAEADPRRGVGSPPGRKKTTASTPRSRKGDAASQFLVFCQKHRDEVVAEHPDASG
EEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRTQDPTEDVE
VEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKR
NRASTAASSALGFSKSSSPSASLTENEVSDSPGDEPSESPYESADETQTEVSVSSKKSER
GVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVC
KESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKG
KMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAHFTARKGKRHHAHVNVSWCFVCSKG
GSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCH
PKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKN
ALQEAEARFREIKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTADISEIPKCNCKP
TDENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTKRQYPETKIIKTDGKGWGLVAK
RDIRKGEFVNEYVGELIDEEECMARIKHAHENDITHFYMLTIDKDRIIDAGPKGNYSRFM
NHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSG
FLGDRPKTSTTLSSEEKGKKTKKKTRRRRAKGEGKRQSEDECFRCGDGGQLVLCDRKFCT
KAYHLSCLGLGKRPFGKWECPWHHCDVCGKPSTSFCHFCPNSFCKEHQDGTAFSCTPDGR
SYCCEHDLGAASVRSAKTEKPPPEPGKPKGKRRRRRGWRRVTEGK
NT seq 4098 nt NT seq  +upstreamnt  +downstreamnt
atggaatttagcatcaagcagagtcccctttctgttcagagtgttgtaaagtgcgtaaag
atgaagcaggcaccagaaatcctcagcagtgccaacgggaaggctccgagctgtgaggtg
aatcgcgagtgttctgtgttcctcagcaaagcccagctctccagcaccctgcaggagggg
gtcatgcagaagtttaacggccacgacgccctgccctttattccggctgacaagctgaaa
gatcttacttcccgggtgtttaatggagaacccggtgcacacgatgccaaactgcgtttt
gagtcccaggaaatgaaagggattgggacaccacctaacactacccctatcaaaaatggc
tctccagaaattaagctgaaaatcaccaaaacgtacatgaatgggaagcctctctttgaa
tcttccatttgtggtgacagtgctgctgatgtgtctcagtcagaagaaaatgcacaaaaa
ccagaaaacaaggcaagaaggaacaggaagaggagcataaaatatgactccttgctggag
cagggccttgtcgaagcagctcttgtgtctaagatctcgagtccttcagataaaaagatt
ccagctaagaaagagtcttgtccaaacactggaagagacaaagaccacctgttgaaatac
aatgtcggtgatttggtgtggtccaaagtgtcgggttacccttggtggccttgcatggtt
tctgcagatccactccttcacagctataccaaactgaaaggtcagaaaaagagtgcacgt
cagtatcacgtacagttctttggtgacgccccagaaagagcttggatatttgagaagagc
ctcgtagcttttgaaggagaaggacagtttgaaaaattatgccaggaaagtgccaagcag
gcacccacgaaagctgagaaaattaagctattgaaacctatttcagggaaattgagggcc
cagtgggaaatgggcattgttcaagcagaagaagctgcaagcatgtcagtggaggagcgg
aaagccaagttcacctttctgtacgtgggggaccagcttcatctcaaccctcaagtagcc
aaggaggctggcattgctgcagagtctttcggagaaatggcagagtcctcaggagtcggt
gaagaggctgctgaaaaccccaagtctgcgagggaagagggcattcccatgaagagaagg
cggagggccaaactgtgtagctctgcagagacccgggagagtgaccccgatgtagtgaag
agtactcctcaaaagacggcagaggctgaccccagaagaggagtagggtctcctcctggg
aggaagaagaccacagcctctacgccacgaagcaggaagggagatgcagcatcccagttt
ttggtcttctgtcaaaaacacagggatgaggtggtagctgagcacccagatgcttcaggt
gaggagattgaagagctgctcaggtcacagtggagtctgctgagtgagaagcagagagcg
cgctacaacaccaagtttgccctggtggcccctgtccaggctgaagaagactctggtaac
gtaaatgggaaaaaaagaaaccacacaaagaggacacaggaccctacagaagatgttgaa
gttgaggacacgcccaggaaaagactcaggacagacaagcacagtcttcggaagagagac
acaatcactgacaaaacggccagaacaagctcttacaaggccatggaggcagcctcctcg
ctcaagagccaggcagcaacgaaaaatctgtctgatgcatgcaaaccactgaagaagcga
aatcgggcttccacggcagcatcttcagctcttgggtttagcaaaagttcatctccttct
gcatccttaactgagaatgaggtctcggacagcccgggagacgagccctcggagtcccca
tatgaaagtgcagatgaaacacaaactgaagtgtctgtctcatccaaaaagtctgagcga
ggagttactgccaaaaaggagtacgtgtgccagctgtgtgagaagccgggcagcctcctg
ctctgtgaaggaccctgctgcggagctttccacctcgcctgccttgggctttcccggagg
ccagaagggaggttcacctgcagcgagtgtgcctcagggattcactcatgtttcgtgtgt
aaagagagcaagacagatgttaagcgctgtgtggtaactcagtgtggaaaattttaccat
gaggcttgtgtgaaaaaataccctctgactgtatttgagagccgaggtttccgctgcccc
cttcacagctgtgtgagctgccacgcttccaacccttcaaacccaaggccgtcaaaaggt
aaaatgatgcggtgtgtccgctgccctgttgcctatcacagcggggatgcttgtctggca
gcaggatgctcagtgatcgcctccaacagcatcatctgcactgcccacttcactgctcgg
aaggggaagcgacaccatgcccacgtcaacgtgagctggtgctttgtgtgctccaaaggg
gggagccttctgtgctgcgagtcctgcccagcggccttccaccctgactgcctgaacatc
gagatgcctgacggcagctggttctgcaatgactgcagggctgggaagaagctgcacttc
caggatatcatttgggtgaaacttgggaactacagatggtggccggcagaagtttgccat
cccaaaaatgttcccccaaatattcagaaaatgaagcacgagattggagaattccctgtg
tttttctttgggtctaaagattattactggacgcatcaggcgcgagtgttcccgtacatg
gagggggaccggggcagccgctaccagggggtcagagggatcggaagagtcttcaaaaac
gcactgcaagaagctgaagctcgttttcgtgaaattaagcttcagagggaagcccgagaa
acacaggagagcgagcgcaagcccccaccatacaagcacatcaaggtgaataagccttat
gggaaagtccagatctacacagcggatatttcagaaatccctaagtgcaactgcaagccc
acagatgagaatccttgtggctttgattcggagtgtctgaacaggatgctgatgtttgag
tgccacccgcaggtgtgtcccgcaggcgagttctgccagaaccagtgcttcaccaagcgc
cagtacccagagaccaagatcatcaagacagatggcaaagggtggggcctggtcgccaag
agggacatcagaaagggagaatttgttaacgagtacgtcggggagctgatcgatgaggag
gagtgcatggcgagaatcaagcacgcacatgagaacgacatcacccacttctacatgctc
actatagacaaggaccgtataattgacgctggccccaaaggaaactactctcgatttatg
aatcacagctgccagcccaactgcgagaccctcaagtggacagtgaacggggacactcgt
gtgggcctgtttgccgtctgcgacattcctgcagggacggagctgacttttaactacaac
ctcgattgtttgggcaatgaaaaaacggtctgtcggtgtggagcctccaattgcagtgga
ttcctcggggatagaccaaagacctcaacgaccctttcttcagaggaaaagggcaaaaag
accaagaagaaaaccaggcggcgcagagcaaaaggggaagggaagaggcagtcggaggac
gagtgcttccgctgcggcgatggtgggcagctggtgctgtgtgaccgcaagttctgcacc
aaggcctaccacctgtcctgcctgggccttggcaagcggcccttcgggaagtgggaatgt
ccttggcatcattgtgacgtgtgtggcaaaccttcaacttcattttgccacttctgcccc
aattcattctgtaaggagcaccaggacgggacagccttcagctgcaccccggacgggcgg
tcctactgctgtgagcatgacttaggggcggcatcggtcagaagcgccaagactgagaag
cccccgccagagccagggaagccaaaggggaagaggcggcggcggaggggctggcggaga
gtcacggagggcaaatag

DBGET integrated database retrieval system