KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104678966
Entry
104678966         CDS       T03989                                 

Gene name
HMX1
Definition
(RefSeq) homeobox protein HMX1
  KO
K09349  homeobox protein Nkx-5
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104678966 (HMX1)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    104678966 (HMX1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 104678966
NCBI-ProteinID: XP_010382712
UniProt: A0A2K6RVX6
LinkDB
Position
2
AA seq 348 aa
MPDELTEPGRATPARASSFLIENLLAAEAKGAGRAAQGDGGREDEEDDDDDPEDEDAEQA
RRRRLQRRRQLLAVTGPGGEARARALLGPGALGLGPRPPPGPGPPFALGCGGAARWYPRA
HGGYGGGLSPDTSDRDSPETGEEMGRAEGAWSRGPGPGAVQREAAELAARGPAAGAEEAS
ELAEVPAAAGETRGGVGVGGGRKKKTRTVFSRSQVFQLESTFDLKRYLSSAERAGLAASL
QLTETQVKIWFQNRRNKWKRQLAAELEAASLSPPGAQRLVRVPVLYHESPPAAAAAGPPA
TLPFPLAPAAPAPPPPLLGFSGALAYPLAAFPAAASVPFLRAQMPGLV
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgcctgacgagctgacggagcccgggcgcgccacgccggcccgcgcctcctccttcctc
atcgagaacctgctcgcagccgaggccaagggcgcagggcgcgcggcccagggcgacggc
ggccgggaggacgaggaggacgacgacgacgaccccgaggacgaggacgccgagcaggcg
cggcggcgacggctacagcggcggcgacagttgctcgcggtcaccgggccgggcggggag
gcgcgggcccgggcgctgctcgggccgggcgcgctgggcctaggtcctcgtccgcccccc
ggtcccggtccgcctttcgctctgggctgcggcggcgcagcgcgctggtacccacgggcg
cacggtggctacggaggcggcctcagtcctgacaccagcgaccgggactcaccggagacg
ggcgaggagatgggccgtgctgagggcgcctggtcgcgaggccccgggccgggagcggtg
cagcgggaggcagcggagctggcggcgcggggcccggcggccggcgcggaagaggcgtcg
gagctggccgaggtccctgcggcggcgggagagacacgcggcggcgttggcgtgggcggc
ggccgaaagaagaagacgcgcacagtcttctcccgcagccaggtcttccagctggagtcc
accttcgacctgaagcgctacctaagcagcgcagagcgtgccggcctggccgcctccctg
cagctcaccgagacgcaggttaagatctggttccagaaccgccgcaacaagtggaagcga
cagctggcggccgagctggaggcggccagcctgtccccgccgggagcgcagcgcctggtc
cgcgtgcccgtgctctaccacgaaagtccccctgccgcggccgccgccgggcccccggcc
actctgcccttcccgctggctcccgccgcgcccgcgccgcccccaccgctgctcggcttc
tctggggccctcgcctacccgctggccgccttcccggccgccgcctccgtgccctttctg
cgggcgcagatgcccggcctggtgtga

DBGET integrated database retrieval system