KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104679640
Entry
104679640         CDS       T03989                                 

Gene name
FGFR1
Definition
(RefSeq) fibroblast growth factor receptor 1 isoform X2
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04520  Adherens junction
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04714  Thermogenesis
rro04810  Regulation of actin cytoskeleton
rro04928  Parathyroid hormone synthesis, secretion and action
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05215  Prostate cancer
rro05218  Melanoma
rro05224  Breast cancer
rro05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104679640 (FGFR1)
   04014 Ras signaling pathway
    104679640 (FGFR1)
   04015 Rap1 signaling pathway
    104679640 (FGFR1)
   04020 Calcium signaling pathway
    104679640 (FGFR1)
   04151 PI3K-Akt signaling pathway
    104679640 (FGFR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104679640 (FGFR1)
   04550 Signaling pathways regulating pluripotency of stem cells
    104679640 (FGFR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104679640 (FGFR1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    104679640 (FGFR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    104679640 (FGFR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104679640 (FGFR1)
   05205 Proteoglycans in cancer
    104679640 (FGFR1)
   05230 Central carbon metabolism in cancer
    104679640 (FGFR1)
  09162 Cancer: specific types
   05218 Melanoma
    104679640 (FGFR1)
   05215 Prostate cancer
    104679640 (FGFR1)
   05224 Breast cancer
    104679640 (FGFR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104679640 (FGFR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rro04090]
    104679640 (FGFR1)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104679640 (FGFR1)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104679640 (FGFR1)
Protein kinases [BR:rro01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   104679640 (FGFR1)
CD molecules [BR:rro04090]
 Proteins
  104679640 (FGFR1)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   104679640 (FGFR1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set FGFR3_TM Ig_5 C2-set_2 Ig_4 Ig_6 Pkinase_fungal DUF1615
Other DBs
NCBI-GeneID: 104679640
NCBI-ProteinID: XP_010383566
UniProt: A0A2K6Q904
LinkDB
Position
9
AA seq 820 aa
MWSWKCLLFWAVLVTATLCTARPSPTLPEQAQPWGAPVEVEAFLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPSSG
TPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHT
YQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGP
DNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEAL
EERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVYKMKSGTKKSDFHSQMAVHKLAKSIP
LRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGK
PLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGKHK
NIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVS
CAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRL
PVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKP
SNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSFPD
TRSSTCSSGEDSVFSHEPLPEEPCLPRHPAQLANGGLKRR
NT seq 2463 nt   +upstreamnt  +downstreamnt
atgtggagctggaagtgcctcctcttctgggctgtgctggtcacagccacgctctgcacc
gctaggccgtccccgaccttgcctgaacaagcccagccctggggagcccctgtggaagtg
gaggccttcctggtccaccccggtgacctgctgcagcttcgctgtcggctgcgggacgat
gtgcagagcatcaactggctgcgggacggggtgcagctggcagaaagcaaccgcacccgc
atcacaggggaggaggtggaggtgcaggactccgtgcccgcggactccggcctctatgct
tgcgtaaccagcagcccctcgggcagcgacaccacctacttctccgtcaatgtttcagat
gctctcccctcctcagaggatgatgatgatgatgatgactcctcttcagaggagaaagag
acagataacaccaaaccaaaccccgtagctccatattggacatccccagaaaagatggaa
aagaaattgcatgcggtgccagctgccaagacagtgaagttcaaatgcccttccagtggg
accccaaaccccacactgcgctggttgaaaaatggcaaagaattcaaacctgaccacagg
attggaggctacaaggtccgttatgccacctggagcatcataatggactccgtggtgcct
tctgacaagggcaactacacctgcattgtggagaatgagtatggcagcatcaaccacacc
taccagctggatgtcgtggagcggtcccctcaccggcccatcctgcaagcagggttgccc
gccaacaagacagtggccctgggtagcaacgtggagttcatgtgtaaggtatacagtgat
ccacagccgcatattcagtggctaaagcacatcgaggtgaacgggagcaagattggtcca
gacaacctgccttatgtccagatcttgaagactgctggagttaataccaccgacaaagag
atggaggtgctccacttaagaaatgtctcctttgaggacgcaggggagtatacgtgcttg
gcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaagctctg
gaagagaggccggcggtgatgacctcgcccctgtacctggagatcatcatctattgcaca
ggggccttcctcatctcctgcatggtagggtcggtcatcgtctacaagatgaagagtggc
accaagaagagcgacttccacagccagatggctgtgcacaagctggccaagagcatccct
ctgcgcagacaggtaacagtgtctgctgactccagtgcgtccatgaactctggggttctt
ctggttcggccatcacggctctcctccagtgggactcccatgctagcaggggtttctgag
tatgagcttcctgaagaccctcgctgggagctgcctcgggacagactggtcttaggcaaa
cccctgggagagggctgctttgggcaggtggtgttggcagaggccatcgggttggacaag
gacaaacccaaccgtgtgaccaaagtggctgtgaagatgttgaagtcggacgcaacagag
aaagacttgtcagacctgatctcagaaatggagatgatgaagatgatcgggaagcataag
aatatcatcaacctgctgggggcctgcacgcaggacggtcccttgtatgtcattgtggag
tatgcctccaagggcaacctgcgggagtacctgcaggcccggaggcccccggggctggaa
tactgctacaaccccagccacaacccagaggagcagctctcctccaaggacctggtgtcc
tgcgcctatcaggtggcccgaggcatggagtatctggcctccaagaagtgcatacaccga
gacctggccgccaggaatgtcctggtgacagaggacaatgtgatgaagatagcagacttt
ggcctcgcacgggacattcaccacatcgactactataaaaagacaaccaacggtcgactg
cctgtgaagtggatggcgcccgaggcattgtttgaccggatctacacccaccagagtgac
gtgtggtctttcggggtgctcctgtgggagatcttcactctgggcggctccccataccct
ggtgtgcctgtggaggagcttttcaagctgctgaaggaaggtcaccgcatggacaagccc
agtaactgtaccaacgagctgtacatgatgatgcgggactgctggcatgcagtgccctca
cagagacccaccttcaagcagctggtggaagacctggaccgcatcgtggccttgacctcc
aaccaggagtacctggacctgtccatgcccctggaccagtactccccgagctttcccgac
acccggagctctacatgctcctcaggggaggattccgtcttctctcatgagccgctgccc
gaggagccctgcctgccccgacacccagcccagcttgccaatggcggactcaaacgccgc
tga

DBGET integrated database retrieval system