KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104679749
Entry
104679749         CDS       T03989                                 

Gene name
PTK2
Definition
(RefSeq) focal adhesion kinase 1 isoform X1
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04012  ErbB signaling pathway
rro04062  Chemokine signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04510  Focal adhesion
rro04670  Leukocyte transendothelial migration
rro04810  Regulation of actin cytoskeleton
rro04935  Growth hormone synthesis, secretion and action
rro05100  Bacterial invasion of epithelial cells
rro05135  Yersinia infection
rro05146  Amoebiasis
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05205  Proteoglycans in cancer
rro05222  Small cell lung cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104679749 (PTK2)
   04370 VEGF signaling pathway
    104679749 (PTK2)
   04151 PI3K-Akt signaling pathway
    104679749 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104679749 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104679749 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    104679749 (PTK2)
   04062 Chemokine signaling pathway
    104679749 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    104679749 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    104679749 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104679749 (PTK2)
   05202 Transcriptional misregulation in cancer
    104679749 (PTK2)
   05205 Proteoglycans in cancer
    104679749 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104679749 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104679749 (PTK2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104679749 (PTK2)
   05100 Bacterial invasion of epithelial cells
    104679749 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104679749 (PTK2)
   05163 Human cytomegalovirus infection
    104679749 (PTK2)
   05165 Human papillomavirus infection
    104679749 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104679749 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104679749 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104679749 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104679749 (PTK2)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     104679749 (PTK2)
Protein kinases [BR:rro01001]
 Non-receptor tyrosine kinases
  FAK family
   104679749 (PTK2)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104679749 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 104679749
NCBI-ProteinID: XP_030793268
LinkDB
Position
9
AA seq 1105 aa
MLLELAGQEALKPAGAIYMEKSGCSPFPVCWAKEYDRYLASSKIMAAAYLDPNLNHTPNS
STKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHK
VKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQ
FTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEV
LEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKE
CFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGML
QLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGASQSFIIRPQKEGERALPSIPKL
ANSEKQGMRTHTVSVSDEISGDETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRCIGE
GQFGDVHQGVYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVI
TENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAAR
NVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGV
CMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFT
ELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGFY
PSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQTSLLDQTDSWNHRPQEIAMWQPNVED
STALDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGS
LQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKPWRLQPQ
EISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLAT
VDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHAL
AVDAKNLLDVIDQARLKMLGQTRPH
NT seq 3318 nt   +upstreamnt  +downstreamnt
atgttgttggaactggcaggccaagaggccctgaaaccagcaggtgccatctatatggag
aaaagcggctgtagtccatttccggtgtgttgggctaaagaatatgacagatacctagca
tctagcaaaataatggcagctgcttaccttgaccccaacttgaatcacacgccaaattcg
agtactaagactcacctgggtactggtatggaacgttctcctggtgcgatggagcgagta
ttaaaggtctttcattattttgaaagcaatagtgagccaaccacctgggccagtattatc
aggcatggagatgctactgatgtcaggggcatcattcagaagatagtggacagtcacaaa
gtaaagcatgtggcctgctatggattccgcctcagtcacctgcggtcagaggaggttcac
tggcttcacgtggatatgggcgtctccagtgtgagggagaagtatgagcttgcccaccca
ccagaggagtggaaatatgaattgagaattcgttatttgccaaaaggatttctaaaccag
tttactgaagataagccaactttgaatttcttctatcaacaggtgaagagcgattatatg
ttagagatagctgatcaagtggaccaggaaattgctttgaagttgggttgtctagaaata
cggcgatcatactgggagatgcggggcaatgcactagaaaagaagtctaactatgaagta
ttagaaaaagatgttggtttaaagcgattttttcctaagagtttactggattctgtcaag
gccaaaacactaagaaaattgatccaacaaacatttagacaattcgccaaccttaataga
gaagaaagtattctgaaattctttgagatcctgtctccagtctacagatttgataaggaa
tgcttcaagtgtgctcttggttcaagctggattatttcagtggaattggcaatcggccca
gaagaagggatcagttacttgacggacaagggctgcaatcccacacatcttgctgacttt
actcaagtgcagaccattcagtattcaaacagtgaagataaggacagaaaaggaatgcta
caactaaaaatagcaggtgcacctgagcctctgacagtgacggcaccatccctaaccatt
gcggagaatatggctgacctgatagatgggtattgccggctggtgaatggagcctcgcag
tcatttatcatcagaccccagaaagaaggtgaacgggctttgccatcaataccaaagttg
gccaacagcgaaaagcaaggcatgcggacacacaccgtctctgtgtcagatgaaattagt
ggggacgaaacagatgattatgctgagattatagatgaagaagatacttacaccatgccc
tcaaccagggattatgagattcaaagagaaagaatagaacttggacgatgtattggagaa
ggccaatttggagatgtacatcaaggcgtttatatgagtccagagaatccagctttggcg
gttgcaattaaaacatgtaaaaactgtacttcggacagcgtgagagagaaatttcttcaa
gaagccttaacaatgcgtcagtttgaccatcctcatattgtgaagctgattggagtcatc
acagagaatcctgtctggataatcatggagctgtgcacacttggagagctgaggtcattt
ttgcaagtaaggaaatacagtttggatctagcatctttgatcttgtatgcctatcagctt
agtacagctcttgcatatctagagagcaaaagatttgtacacagggacattgctgctcgg
aatgttctggtgtcctcaaatgattgtgtaaagttaggagactttggattatcccgatat
atggaagatagtacttactacaaagcttccaaaggaaaattgcctattaaatggatggct
ccagagtcaatcaattttcgacgttttacctcagctagtgacgtatggatgtttggtgtg
tgtatgtgggagatactgatgcatggtgtgaagccttttcaaggagtgaagaacaatgat
gtgatcggtcgaattgaaaatggggaaagattaccaatgcctccaaattgtcctcctacc
ctctacagccttatgacgaaatgctgggcctatgaccccagcaggcggcccaggtttact
gaacttaaagctcagctcagcacaatcctggaggaagagaaggctcagcaagaagaacgc
atgaggatggagtccagaagacaggccacagtgtcctgggactccggagggtctgatgaa
gcgccacccaagcccagcagaccgggttatcctagtccgaggtccagcgaaggattttat
cccagcccacagcacatggtacaaaccaatcattaccaggtttctggctaccctggttca
catggaatcacagccatggctggcagcatctatccaggtcagacatctcttttggaccaa
acagattcatggaatcatagacctcaggagatagcaatgtggcagcccaatgtggaggac
tctacagcattggacctgcgagggattgggcaagtgttgccaacccacctgatggaagag
cggctaatccgacaacaacaggaaatggaagaagatcagcgctggctggaaaaagaggaa
agatttctgaaacctgatgtgagactctctcgaggcagtattgacagggaggatggaagt
cttcagggtccgattggaaaccaacatatatatcagcctgtgggtaaaccagatcctgca
gctccaccaaagaaaccgcctcgccctggagctcccggtcacctgggaagccttgccagc
ctcagcagccctgctgacagctacaacgagggtgtcaagccatggaggcttcagccccag
gaaatcagcccccctcctactgccaacctggaccggtcaaatgataaggtgtacgagaat
gtgacgggcctggtgaaagctgtcatcgagatgtccagtaaaatccagccagccccacca
gaggagtatgtccctatggtgaaggaagtcggcttggccctgaggacgttattggccact
gtggatgagaccattcccctcctaccagccagcacccaccgagagattgagatggcacag
aaactattgaactctgacctgggtgagctcatcaacaagatgaaactggcccagcagtat
gtcatgaccagtctccagcaagagtacaaaaagcaaatgctgactgctgctcacgccctg
gctgtggatgccaaaaacttactcgatgtcattgaccaagcaagactgaaaatgcttggg
cagacgagaccacactga

DBGET integrated database retrieval system