KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104679840
Entry
104679840         CDS       T03989                                 

Gene name
TAS1R2
Definition
(RefSeq) taste receptor type 1 member 2
  KO
K04625  taste receptor type 1 member 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
rro04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    104679840 (TAS1R2)
  09157 Sensory system
   04742 Taste transduction
    104679840 (TAS1R2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104679840 (TAS1R2)
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104679840 (TAS1R2)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 NCD3G DUF3408 Ephrin_rec_like
Other DBs
NCBI-GeneID: 104679840
NCBI-ProteinID: XP_010383867
UniProt: A0A0M4PM72
LinkDB
Position
12
AA seq 839 aa
MRPRATTICSLFFLLRVLAEPAKNSDFYLPGDYLLGGLFTLHANMKGIVHLDFLQVPMCK
EYETKVMGYNLMQAMRFAVEEINNDSSLLPDVLLGYEMVDVCYISNNVQPVLYFLAQDNN
LLPIHEDYSNYMPRVVAVIGPDNSDAVMTVANFLSLFLLPQITYSAISDGLRDKVRFPAL
LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGNRLARGDICIAFQETL
PTMQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYNFFNEVLRQNFTGAVWIA
SESWAIDPVLHNLTELRHIGTFLGITIQSVPIPGFSEFRVRGPQAGPSPLSRTSQRSTCN
QECDNCLNGTLSFNTVLRLSGERVVYSVYSAVYAVAHALHSLLGCDHGTCTKREVYPWQL
LEKIWKVNFTLLDHQLFFDPQGDMALHLEIVQWQWDLSQNPFQSVASYYPLQRQLKTIQD
ISWHTINNTVPVSMCSKRCQSGQKKKPVGVHICCFECIDCLPGTFLNQTEDEYECQACPS
NEWSHQREASCFKRQLAFLEWHEAPTIVVALLAALGFLSTLAILVIFWRHFQTPMVRSAG
GPMCFLMLTLLLVAYVVVPVYVGPPKVSTCLCRQVLFPLCFTICISCITVRSFQIVCVFK
MASRFPRAYSYWVRYQGPYVSMAFIMVLKMVTMVIGILATGLNPTTHVDPDDPKIMIVSC
NPNYRNSLLFNTSLDLLLSVLGFSFAYVGKELPTNYNEAKFITLSMTFYFTSSVSLCTFM
SAYNGVLVTIMDLLVTVLNLLAISLGYFGPKCYMILFYPERNTPAYFNSMIQGYTMRRD
NT seq 2520 nt   +upstreamnt  +downstreamnt
atgcggcccagggcaacgaccatctgctccctgttcttcctgctacgggtcctggctgag
ccggctaaaaactcggacttctacctgcctggggattacctcctgggtggcctcttcacc
ctccatgccaacatgaagggcattgttcaccttgacttcctgcaggtgcccatgtgcaag
gagtatgaaacgaaggtgatgggctacaacctcatgcaggccatgcgctttgcggtggag
gagatcaacaatgacagcagcctgctgcctgatgtgctgctaggctatgagatggtggat
gtgtgctacatctccaacaacgtccagccggtgctctacttcctggcacaggataacaac
ctccttcccatccatgaggactacagtaactacatgccccgtgtggtggctgtcattggc
cctgacaactccgacgctgtcatgactgtggccaacttcctctccctctttcttcttcca
cagatcacctatagtgccatcagcgatgggctgcgagacaaggtgcgcttcccggccttg
ctgcgcaccacacccagcgccgaccaccacatcgaggccatggtgcagctgatgctgcac
ttccgctggaactggatcatcgtgctggtgagcagcgacacctatggccgtgacaatggc
cagctgcttggcaatcgcctggcccggggtgacatctgcatcgccttccaggagacactg
cccacaatgcagcccaaccagaacatgacgtcagaggagcgccagcgcctggtgaccatc
gtggacaagctgcagcagagcacggcacgcgtcgtggtcgtgttctcacccgacctgacc
ctgtacaacttcttcaatgaggtgctgcgccagaacttcacgggtgccgtgtggatcgcc
tctgagtcctgggccatcgacccggtcctgcacaacctcacagagctgcgccacataggc
accttcctgggcatcaccatccagagcgtgcccatcccgggcttcagtgagttccgtgtg
cgaggcccacaggctgggccgtcacccctcagcaggaccagccagaggtctacctgcaac
caagagtgtgacaactgcctgaatggcaccttgtccttcaacactgttctcaggctctct
ggggagcgtgtcgtctacagcgtgtactctgcggtctatgccgtggcccacgccctgcac
agcctcctcggctgtgaccatggcacctgtaccaagagggaggtctacccctggcagctg
cttgagaagatctggaaggtcaacttcactctcctggaccaccaactcttcttcgacccg
caaggggacatggctctgcacttggagattgtccagtggcaatgggacctgagccagaat
cccttccagagcgttgcctcctactaccccctgcagcgacagctgaagacaatccaagac
atctcctggcacaccatcaacaacacggtccctgtgtccatgtgttccaagaggtgccag
tcggggcaaaagaagaagcccgtgggcgtccatatctgctgcttcgagtgcattgactgc
cttcccggcaccttcctcaaccagactgaagatgaatacgaatgccaggcctgcccgagt
aacgagtggtcccaccagagagaggcctcctgcttcaagcggcagctggccttcctggaa
tggcatgaggcacccaccatcgttgtggccctgctggctgccctgggcttcctcagcacc
ctggccatcctggtgatattctggaggcacttccagacgcccatggttcgctcagctggg
ggccccatgtgcttcctgatgctgacgctgctgttggtggcatacgtggtggtcccggtg
tacgtggggccgcccaaggtctccacctgcctctgccgccaggtcctctttcccctctgc
ttcaccatctgcatctcttgcatcaccgtgcgctctttccagatcgtctgtgtcttcaag
atggccagccgcttcccgcgcgcctacagctactgggtccgctaccaggggccctacgtc
tctatggcgtttatcatggtactcaaaatggtcactatggtgattggcatactggccaca
ggcctcaatcccaccacccatgttgaccccgatgaccccaagatcatgatcgtctcctgc
aaccccaactaccgcaacagcctgctcttcaacaccagcctggacctgctgctctcagtg
ctgggtttcagcttcgcctacgtgggcaaggaactgcccaccaactacaacgaggccaag
ttcatcaccctcagcatgaccttctatttcacctcatccgtctccctctgcaccttcatg
tctgcctacaacggggtgctggtcaccatcatggacctcttggtcactgtgctcaacctc
ctggccatcagcctgggctacttcggccccaagtgctacatgatcctcttctacccggag
cgcaacacgcccgcctacttcaacagcatgatccagggctacaccatgaggagggactag

DBGET integrated database retrieval system