KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680094
Entry
104680094         CDS       T03989                                 

Gene name
GNB3
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
  KO
K07825  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04014  Ras signaling pathway
rro04062  Chemokine signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04371  Apelin signaling pathway
rro04713  Circadian entrainment
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04727  GABAergic synapse
rro04728  Dopaminergic synapse
rro04742  Taste transduction
rro04926  Relaxin signaling pathway
rro05032  Morphine addiction
rro05034  Alcoholism
rro05163  Human cytomegalovirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    104680094 (GNB3)
   04371 Apelin signaling pathway
    104680094 (GNB3)
   04151 PI3K-Akt signaling pathway
    104680094 (GNB3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    104680094 (GNB3)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    104680094 (GNB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    104680094 (GNB3)
   04727 GABAergic synapse
    104680094 (GNB3)
   04725 Cholinergic synapse
    104680094 (GNB3)
   04728 Dopaminergic synapse
    104680094 (GNB3)
   04726 Serotonergic synapse
    104680094 (GNB3)
   04723 Retrograde endocannabinoid signaling
    104680094 (GNB3)
  09157 Sensory system
   04742 Taste transduction
    104680094 (GNB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104680094 (GNB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104680094 (GNB3)
  09165 Substance dependence
   05032 Morphine addiction
    104680094 (GNB3)
   05034 Alcoholism
    104680094 (GNB3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104680094 (GNB3)
   05163 Human cytomegalovirus infection
    104680094 (GNB3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104680094 (GNB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104680094 (GNB3)
   04031 GTP-binding proteins [BR:rro04031]
    104680094 (GNB3)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   104680094 (GNB3)
GTP-binding proteins [BR:rro04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    104680094 (GNB3)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A WD40_like Cytochrom_D1
Other DBs
NCBI-GeneID: 104680094
NCBI-ProteinID: XP_010384209
UniProt: A0A2K6NNK8
LinkDB
Position
10
AA seq 340 aa
MGEMEQLRQEAEQLKKQIADARKACADVTLAELVSGLEVAGRVQMRTRRTLRGHLAKIYA
MHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNM
CSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVF
VGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEA
ICTGSDDASCRLFDLRADQELICFSHESIICGITSVAFSLSGRLLFAGYDDFNCNVWDSM
KSERVGILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgggggagatggagcaactgcgtcaggaagcggagcagctcaagaagcagattgcagat
gccaggaaagcctgtgctgacgttactctggcagagctggtgtctggcctagaggtagcg
ggacgagtccagatgcggacgcggcggacgttaagggggcacctggccaagatctatgcc
atgcactgggccactgactccaagctgctggtaagtgcctcgcaagatgggaagctgatc
gtgtgggacagctacaccaccaacaaggtgcacgccatcccactgcgctcctcctgggtg
atgacctgtgcctatgccccatcagggaactttgtggcatgtggagggctggacaacatg
tgttccatctacaacctcaaatcccgtgagggcaatgtcaaggtcagccgggagctttct
gctcacacaggttatctctcctgctgccgcttcctggatgacaacaatattgtgaccagc
tcgggggacaccacgtgtgccttgtgggacattgagactgggcagcagaagactgtattt
gtgggacacacgggtgactgcatgagcctggctgtgtctcctgacttcaatctcttcatt
tcgggggcctgtgatgccagcgccaagctctgggatgtgcgagaggggacctgccgtcag
actttcactggccacgagtcggacatcaacgccatctgtttcttccccaatggagaggcc
atctgtacgggctcggatgatgcttcctgccgcttgtttgacctgcgggcagaccaggag
ctgatctgcttctcccatgagagcatcatctgcggcatcacgtccgtggccttctccctc
agtggccgcctgctattcgctggctacgacgacttcaactgcaatgtctgggactccatg
aagtccgagcgtgtgggcatcctctctggccacgacaacagggtcagctgcctgggagtc
acagctgatgggatggctgtggccacaggttcctgggacagcttcctcaaaatctggaac
tga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680203
Entry
104680203         CDS       T03989                                 

Gene name
GNAT3
Definition
(RefSeq) guanine nucleotide-binding protein G(t) subunit alpha-3
  KO
K19729  guanine nucleotide-binding protein G(t) subunit alpha 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
rro04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    104680203 (GNAT3)
  09157 Sensory system
   04742 Taste transduction
    104680203 (GNAT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rro04031]
    104680203 (GNAT3)
GTP-binding proteins [BR:rro04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    104680203 (GNAT3)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB DAP3 AAA_29
Other DBs
NCBI-GeneID: 104680203
NCBI-ProteinID: XP_030788901
LinkDB
Position
6
AA seq 354 aa
MGSGISSESKESAKRSKELEKKLQEEAERDARTVKLLLLGAGESGKSTIVKQMKIIHKNG
YSEQECMEFKAVIYSNTLQSILAIVKAMTTLGIDYVNPRSAEDQRQLYAMANTLEDGGMT
PQLAEVIKRLWRDPGIQACFERASEYQLNDSAAYYLNDLDRITASGYVPNEQDVLHSRVK
TTGIIETQFSFKDLHFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDEEV
NRMHESLHLFNSICNHKYFSTTSIVLFLNKKDIFQEKVTKVHLSICFPEYTGPNTFEDAG
NYIKNQFLDLNLKKEDKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggaagtggaattagttcagagagcaaggagtcagccaaaagatcaaaagaactggag
aaaaagcttcaggaggaggctgagcgagacgcaagaactgtaaagctgctactattagga
gcaggagaatctggcaaaagtactattgttaaacaaatgaagatcatccataagaatggt
tacagtgagcaagaatgcatggagttcaaagcagtaatttacagtaatacattgcaatcc
atcctagctattgtgaaagccatgactacccttggaattgattatgtaaatcccagaagt
gcagaggaccaacgacaactttatgcaatggcaaataccctggaagatggtggcatgacg
cctcaactggctgaggtaataaaacggctgtggagagatccgggaattcaggcctgcttt
gaaagggcatctgagtatcagctcaatgactcagcagcttactaccttaatgatttagat
agaataacagcatctgggtatgtgccaaatgaacaagatgttctccattctcgagtgaaa
acaactggaatcattgaaactcaattctcctttaaagacttgcacttcaggatgtttgat
gtaggtggacagagatctgagagaaagaagtggattcactgctttgaaggagttacatgc
attatattttgtgctgcacttagtgcctatgacatggtcctcgtggaagatgaagaagtg
aatagaatgcatgaaagtcttcacctgttcaacagtatctgtaatcacaagtatttttca
acaacctccattgtcctgttcctcaacaaaaaagatatctttcaagaaaaggtaaccaag
gtgcatcttagtatctgctttccagaatataccgggccaaatacatttgaagatgcagga
aactacatcaagaaccagttcctagacctgaatttaaaaaaagaagataaggaaatttat
tcccacatgacctgtgctactgatacccaaaatgtcaagtttgtgtttgatgcagttaca
gatataataatcaaagagaatctaaaagactgtgggcttttctaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 115895307
Entry
115895307         CDS       T03989                                 

Gene name
GNG13
Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
  KO
K04547  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04014  Ras signaling pathway
rro04062  Chemokine signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04371  Apelin signaling pathway
rro04713  Circadian entrainment
rro04723  Retrograde endocannabinoid signaling
rro04724  Glutamatergic synapse
rro04725  Cholinergic synapse
rro04726  Serotonergic synapse
rro04727  GABAergic synapse
rro04728  Dopaminergic synapse
rro04740  Olfactory transduction
rro04742  Taste transduction
rro04926  Relaxin signaling pathway
rro05032  Morphine addiction
rro05034  Alcoholism
rro05163  Human cytomegalovirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    115895307 (GNG13)
   04371 Apelin signaling pathway
    115895307 (GNG13)
   04151 PI3K-Akt signaling pathway
    115895307 (GNG13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    115895307 (GNG13)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    115895307 (GNG13)
  09156 Nervous system
   04724 Glutamatergic synapse
    115895307 (GNG13)
   04727 GABAergic synapse
    115895307 (GNG13)
   04725 Cholinergic synapse
    115895307 (GNG13)
   04728 Dopaminergic synapse
    115895307 (GNG13)
   04726 Serotonergic synapse
    115895307 (GNG13)
   04723 Retrograde endocannabinoid signaling
    115895307 (GNG13)
  09157 Sensory system
   04740 Olfactory transduction
    115895307 (GNG13)
   04742 Taste transduction
    115895307 (GNG13)
  09159 Environmental adaptation
   04713 Circadian entrainment
    115895307 (GNG13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    115895307 (GNG13)
  09165 Substance dependence
   05032 Morphine addiction
    115895307 (GNG13)
   05034 Alcoholism
    115895307 (GNG13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    115895307 (GNG13)
   05163 Human cytomegalovirus infection
    115895307 (GNG13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    115895307 (GNG13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rro04031]
    115895307 (GNG13)
GTP-binding proteins [BR:rro04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    115895307 (GNG13)
SSDB
Motif
Pfam: G-gamma Toxin_YhaV
Other DBs
NCBI-GeneID: 115895307
NCBI-ProteinID: XP_030781477
LinkDB
Position
20
AA seq 67 aa
MEEWDVPQMKKEVESLKHQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVE
KGKCTIL
NT seq 204 nt   +upstreamnt  +downstreamnt
atggaggagtgggacgtgccacagatgaagaaagaggtggagagcctcaagcaccagctg
gccttccagcgggagatggcatccaagaccatccccgagctgctgaagtggatcgaggat
gggatccccaaagaccccttcctgaaccctgacctgatgaagaacaacccatgggtagaa
aagggcaaatgcaccatcctgtga

DBGET integrated database retrieval system