KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680220
Entry
104680220         CDS       T03989                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform X1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04380  Osteoclast differentiation
rro04612  Antigen processing and presentation
rro04668  TNF signaling pathway
rro04710  Circadian rhythm
rro04713  Circadian entrainment
rro04714  Thermogenesis
rro04725  Cholinergic synapse
rro04728  Dopaminergic synapse
rro04911  Insulin secretion
rro04915  Estrogen signaling pathway
rro04916  Melanogenesis
rro04918  Thyroid hormone synthesis
rro04922  Glucagon signaling pathway
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04931  Insulin resistance
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro04962  Vasopressin-regulated water reabsorption
rro05016  Huntington disease
rro05020  Prion disease
rro05030  Cocaine addiction
rro05031  Amphetamine addiction
rro05034  Alcoholism
rro05152  Tuberculosis
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05203  Viral carcinogenesis
rro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    104680220 (CREB1)
   04024 cAMP signaling pathway
    104680220 (CREB1)
   04022 cGMP-PKG signaling pathway
    104680220 (CREB1)
   04151 PI3K-Akt signaling pathway
    104680220 (CREB1)
   04152 AMPK signaling pathway
    104680220 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    104680220 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    104680220 (CREB1)
   04922 Glucagon signaling pathway
    104680220 (CREB1)
   04915 Estrogen signaling pathway
    104680220 (CREB1)
   04926 Relaxin signaling pathway
    104680220 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    104680220 (CREB1)
   04918 Thyroid hormone synthesis
    104680220 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    104680220 (CREB1)
   04916 Melanogenesis
    104680220 (CREB1)
   04924 Renin secretion
    104680220 (CREB1)
   04925 Aldosterone synthesis and secretion
    104680220 (CREB1)
   04927 Cortisol synthesis and secretion
    104680220 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104680220 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    104680220 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    104680220 (CREB1)
   04728 Dopaminergic synapse
    104680220 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104680220 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    104680220 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    104680220 (CREB1)
   04713 Circadian entrainment
    104680220 (CREB1)
   04714 Thermogenesis
    104680220 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104680220 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    104680220 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    104680220 (CREB1)
   05020 Prion disease
    104680220 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    104680220 (CREB1)
   05031 Amphetamine addiction
    104680220 (CREB1)
   05034 Alcoholism
    104680220 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    104680220 (CREB1)
   04934 Cushing syndrome
    104680220 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104680220 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104680220 (CREB1)
   05161 Hepatitis B
    104680220 (CREB1)
   05163 Human cytomegalovirus infection
    104680220 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104680220 (CREB1)
   05165 Human papillomavirus infection
    104680220 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104680220 (CREB1)
   03029 Mitochondrial biogenesis [BR:rro03029]
    104680220 (CREB1)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    104680220 (CREB1)
Mitochondrial biogenesis [BR:rro03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    104680220 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 104680220
NCBI-ProteinID: XP_010384370
UniProt: A0A2K6Q2B5
LinkDB
Position
14
AA seq 341 aa
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagccgagaaccagcagagtggagatgcagctgtaacagaagct
gaaaaccaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctccaactgtaactctagtacagctgcccaat
gggcagacagttcaagtccatggagtcattcaggcggcccagccatcagttattcagtct
ccacaagtccaaacagttcagtcttcctgtaaggacttaaaaagacttttctccggaaca
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaactgat
tcccaaaagcgaagggaaattctttcaaggaggccttcttacaggaaaattttgaatgac
ttatcttctgatgcaccaggagtgccaaggattgaagaagagaagtctgaagaggagacc
tcagcacctgccatcaccactgtaacggtgccaactccaatttaccaaactagcagtgga
cagtatattgccattacccagggaggagcaatacaactggctaacaatggtaccgatggg
gtacagggcctgcaaacattaaccatgaccaatgcagccgccactcagccgggtactacc
attctacagtatgcacagaccactgatggacagcagatcttagtgcccagcaaccaagtt
gttgttcaagctgcctctggagatgtacaaacataccagattcgcacagcacccactagc
actattgcccctggagttgttatggcatcctccccagcacttcctacacagcctgctgaa
gaagcagcacgaaagagagaggttcgtctaatgaagaacagggaagcagctcgagagtgt
cgtagaaagaagaaagaatatgtgaaatgtttagaaaacagagtggcagtgcttgaaaat
caaaacaagacattgattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

DBGET integrated database retrieval system