KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680251Help
Entry
104680251         CDS       T03989                                 

Gene name
TIMP3
Definition
(RefSeq) metalloproteinase inhibitor 3
  KO
K16866  metalloproteinase inhibitor 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    104680251 (TIMP3)
   05205 Proteoglycans in cancer
    104680251 (TIMP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rro01002]
    104680251 (TIMP3)
Peptidases and inhibitors [BR:rro01002]
 Peptidase inhibitors
  Family I35: timp family
   104680251 (TIMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIMP
Motif
Other DBs
NCBI-GeneID: 104680251
NCBI-ProteinID: XP_030771278
LinkDB All DBs
Position
13
AA seq 211 aa AA seqDB search
MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTL
VYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNF
VERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSK
HYACIRQKGGYCSWYRGWAPPDKSIINATDP
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgactccttggctcgggctcatcgtgctcctgggcagctggagcctgggggactggggc
gccgaggcgtgcacatgctcgcccagccacccccaggacgccttctgcaactctgacatc
gtgatccgggccaaggtggtggggaagaagctggtaaaggaggggcccttcggcacgctg
gtctacaccatcaagcagatgaagatgtaccgaggcttcaccaagatgccccacgtgcag
tacatccacacggaagcttccgagagtctctgtggccttaagctggaggtcaacaagtac
cagtacctgctgacaggtcgcgtctatgatggcaagatgtacacagggctgtgcaacttt
gtggagaggtgggaccagctcaccctctcccagcgcaaggggctgaattatcggtaccac
ctgggttgtaactgcaagatcaagtcctgctactacctgccttgctttgttacttccaag
aacgagtgtctctggaccgacatgctctccaatttcggctaccctggctaccagtccaaa
cactatgcctgcatccggcagaagggcggctactgcagctggtaccgaggatgggccccc
ccggacaaaagcatcatcaatgccacagacccctga

DBGET integrated database retrieval system