KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680269
Entry
104680269         CDS       T03989                                 

Gene name
SGCA
Definition
(RefSeq) alpha-sarcoglycan isoform X1
  KO
K12565  alpha-sarcoglycan
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104680269 (SGCA)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104680269 (SGCA)
   05414 Dilated cardiomyopathy
    104680269 (SGCA)
   05416 Viral myocarditis
    104680269 (SGCA)
SSDB
Motif
Pfam: Sarcoglycan_2
Other DBs
NCBI-GeneID: 104680269
NCBI-ProteinID: XP_010384428
UniProt: A0A2K6QDU0
LinkDB
Position
19
AA seq 424 aa
MAVTLFWTPLLVVLLAGLGDTEAQQTTLHPLVGRVFVHTLDHQTFLSLSEHVAVPPAVRI
TYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGRQVIEVTAYNRDSFDTTQQRL
VLEIGDSEGPLLPYQAEFLVRSHDVEEVLPSTPASRFLSALGGLWEPGELQLLNITSALD
RGGRVPLPIEGRKEGVYIKVGSASPFSTCLKMVASPDSHARCAQGQPPLLSCYDTLAPHF
RIDWCNVTLVDKSVPEPADEMPTPGDGILEHDPFFCPPTEAPDRDFLVDALVTLLVPLLV
ALLLTLLLAYVMCCRREGRLKRDLATSESDFSGPRVLQAPRPSPGDFCARGRAFGTVCWW
WSGSGIQMVHHCTIHGNTEELRQMAASREVPRPLSTLPMFNVRTGERLPPRVDSAQVPLI
LDQH
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggctgtgacactcttctggactcctctcctcgtggttctcctggcaggactgggggac
accgaggcccagcagaccacgctacacccacttgtgggccgtgtatttgtgcacactttg
gaccatcagacgtttctgagcctttctgagcacgttgctgtcccacccgctgtccgcatc
acctaccacgcccacctccagggacacccagacctgccccggtggctccgctacacccag
cgcagcccgcaccaccctggcttcctctacggctctgccaccccagaagatcgtgggcgc
caggtcattgaggtcacagcctacaatcgggacagctttgataccactcagcagaggctg
gtgctggagattggggactcggaaggccccctgctgccataccaagctgagttcctggtg
cgcagccatgatgtggaggaggtgctgccttcaacgcctgccagccgcttcctctcagct
ttggggggactctgggagcctggagagcttcagctgctcaacatcacttctgccttggac
cgtgggggccgtgtcccccttcccattgagggccgcaaagaaggggtgtacattaaggtg
ggttctgcctcacctttctctacttgcctgaagatggtggcatcccccgatagccacgcc
cgttgtgcccagggccaacctccacttctgtcttgctacgacactttggcaccccacttc
cgcattgactggtgcaatgtgaccctggtggataagtcagtcccggagcctgcagatgag
atgcccaccccaggcgatgggatcctggagcatgacccgttcttctgcccacccactgag
gccccagaccgtgacttcttggtggatgctctggtcaccctcctggtgcccctgctggtg
gccctgcttctcactttgctgctggcctatgtcatgtgctgccggcgggagggaaggctg
aagagagacctggctacctctgaatcagatttcagcggtcccagagtcctccaggcccca
cgaccctctcctggggatttctgtgccagaggccgtgctttcgggactgtgtgttggtgg
tggagtgggagtggcatccagatggtccaccactgcaccatccatgggaacacagaggag
ctgcgtcagatggcggccagccgcgaggtgccccggccactctccaccctgcccatgttc
aatgtgcgcacgggcgagcggctgcctccccgcgtggacagcgcccaggtgcccctcatt
ctggaccagcactga

DBGET integrated database retrieval system