KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680310
Entry
104680310         CDS       T03989                                 

Gene name
STAT5A
Definition
(RefSeq) signal transducer and activator of transcription 5A isoform X1
  KO
K11223  signal transducer and activator of transcription 5A
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04012  ErbB signaling pathway
rro04217  Necroptosis
rro04630  JAK-STAT signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04917  Prolactin signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro05161  Hepatitis B
rro05162  Measles
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104680310 (STAT5A)
   04630 JAK-STAT signaling pathway
    104680310 (STAT5A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104680310 (STAT5A)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    104680310 (STAT5A)
   04659 Th17 cell differentiation
    104680310 (STAT5A)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    104680310 (STAT5A)
   04935 Growth hormone synthesis, secretion and action
    104680310 (STAT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104680310 (STAT5A)
   05203 Viral carcinogenesis
    104680310 (STAT5A)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    104680310 (STAT5A)
   05220 Chronic myeloid leukemia
    104680310 (STAT5A)
   05223 Non-small cell lung cancer
    104680310 (STAT5A)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104680310 (STAT5A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104680310 (STAT5A)
   05161 Hepatitis B
    104680310 (STAT5A)
   05162 Measles
    104680310 (STAT5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104680310 (STAT5A)
Transcription factors [BR:rro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    104680310 (STAT5A)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 104680310
NCBI-ProteinID: XP_010384529
LinkDB
Position
19
AA seq 794 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNCSSPAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLSPQERLSRETALRQKQVSLETWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSSLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGSGSATY
MDQAPSPAVCPQAHYNMYPQNPDPVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLS
PPAGLFTSARGSLS
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggcgggctggatccaggcccagcagctgcagggagatgcgctgcgccagatgcaggtg
ctgtacggccagcacttccccatcgaggtccgtcactacttggcccagtggattgagagc
cagccatgggatgccattgacttggacaatccccaggacagagcccaagccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcggagcaccaggtgggggaagatggg
tttttactgaagatcaagctggggcactacgccacacagctccagaacacgtatgaccgc
tgccccatggagctggtccgctgcatccggcacattctgtacaatgaacagaggctggtc
cgagaagccaacaactgcagttctccggctgggatcctggttgacgccatgtcccagaaa
caccttcagatcaaccagacattcgaggagctgcgactggtcacgcaggacacagagaat
gagctgaagaagctgcagcagactcaggaatacttcatcatccagtaccaggagagcctg
aggatccaagctcagtttgcccagctggcccagctgagcccccaggagcgtctgagccgg
gagacagccctccggcagaagcaggtgtctctggagacgtggctgcagcgcgaggcacag
acgctgcagcagtaccgtgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctagatgacgagctgatccagtggaagcggcggcagcag
ctggccgggaacggcgggccccccgagggcagcctggacgtgctacagtcctggtgtgag
aagttggccgagatcatctggcagaaccggcagcagatccgcagggctgagcacctctgc
cagcagctgcccatccctggcccagtggaggagatgctggctgaggtcaacgccaccatc
acggacatcatctcagccctggtgaccagcacattcatcattgagaagcagcctcctcag
gtcctgaagacccagaccaagtttgcagccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaacccgccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tctctgctcaagaacgagaacacccgcaacgagtgcagtggtgagatcctgaacaactgc
tgcgtgatggagtaccaccaagccacgggcaccctcagcgcccactttaggaacatgtca
ctgaagaggatcaagcgtgctgaccggcggggtgcagagtccgtgacagaggagaagttc
acagtcctgtttgagtctcagttcagtgttggcagcaatgagcttgtgttccaggtgaag
actctctccctacctgtggttgtcatcgtccacgggagccaggaccacaatgccacggcc
accgtgctgtgggacaacgcctttgctgagccgggcagggtgccatttgccgtgcctgac
aaagtgctgtggccgcagctgtgtgaggcgctgaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaaccttgtgttcctggcgcagaaactgttcaacaac
agcagcagccacctggaggactacagcagcctgtccgtgtcctggtcccagttcaacagg
gagaacttgccgggctggaactacaccttctggcagtggtttgacggggtgatggaggtg
ttgaagaagcaccacaagccccactggaatgatggggccatcctaggttttgtgaataag
caacaggcccatgacctgctcatcaacaagcccgatgggaccttcttgttgcgctttagt
gactcagaaattgggggtatcaccatcgcctggaaatttgactccccggaacgcaacctg
tggaacctgaaaccattcaccacacgggatttctccatcaggtccctggctgaccggctg
ggggacctgagctatctcatctatgtgtttcctgaccgccccaaggatgaggtcttctcc
aagtactacactccagtgctggctaaagctgttgatggatacgtgaagccacagatcaag
caagtggtccctgagtttgtgaacgcatctgcagatgccgggagcggcagtgccacgtac
atggaccaggccccctccccagctgtgtgcccccaggctcactataacatgtacccacag
aaccctgaccctgtccttgaccaggatggagaattcgacctggatgagaccatggatgtg
gccaggcacgtggaggaactcttacgccgaccgatggacagtcttgactcccgcctctcg
ccccctgccggtcttttcacctctgccagaggctccctctcatga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680321
Entry
104680321         CDS       T03989                                 

Definition
(RefSeq) signal transducer and activator of transcription 5B isoform X1
  KO
K11224  signal transducer and activator of transcription 5B
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04012  ErbB signaling pathway
rro04062  Chemokine signaling pathway
rro04217  Necroptosis
rro04630  JAK-STAT signaling pathway
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04917  Prolactin signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro05161  Hepatitis B
rro05162  Measles
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104680321
   04630 JAK-STAT signaling pathway
    104680321
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104680321
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    104680321
   04659 Th17 cell differentiation
    104680321
   04062 Chemokine signaling pathway
    104680321
  09152 Endocrine system
   04917 Prolactin signaling pathway
    104680321
   04935 Growth hormone synthesis, secretion and action
    104680321
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104680321
   05203 Viral carcinogenesis
    104680321
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    104680321
   05220 Chronic myeloid leukemia
    104680321
   05223 Non-small cell lung cancer
    104680321
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104680321
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104680321
   05161 Hepatitis B
    104680321
   05162 Measles
    104680321
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104680321
Transcription factors [BR:rro03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    104680321
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 104680321
NCBI-ProteinID: XP_030779992
LinkDB
Position
19
AA seq 787 aa
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGS
GSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQ
WIPHAQS
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggctgtgtggatacaagctcagcagctccaaggagaagcccttcatcagatgcaagcg
ttatatggccagcattttcccattgaggtgcggcattatttatcccagtggattgaaagc
caagcctgggactcaatagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcggagcaccaggtgggggaagatggg
tttttactgaagatcaagctggggcactacgccacgcagctccagaacacgtatgaccgc
tgccccatggagctggtccgctgcatccgccatatattgtacaatgagcagagattggtc
cgagaagccaacaatggtagttctccagctggaagccttgctgacgccatgtcccagaaa
cacctccagatcaaccagacgtttgaggagctgcgactggtcacgcaggacacagagaat
gagctgaagaagctgcagcagactcaggagtacttcatcatccagtaccaggagagcctg
aggatccaagctcagtttggcccgctggcccagctgagcccccaggagcgtctgagccgg
gagacagccctccagcagaagcaggtgtctctggaggcgtggctgcagcgcgaggcacag
acgctgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctagatgacgagctgatccagtggaagcggcggcagcag
ctggccgggaacggcgggccccccgagggcagcctggacgtgctacagtcctggtgtgag
aagttggccgagatcatctggcagaaccggcagcagatccgcagggctgagcacctctgc
cagcagctgcccatccctggcccagtggaggagatgctggctgaggtcaacgccaccatc
acggacatcatctcagccctggtgaccagcacattcatcattgagaagcagcctcctcag
gtcctgaagacccagaccaagtttgcagccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaacccgccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tctctgctcaagaacgagaacacccgcaatgattacagtggcgagatcttgaacaactgc
tgtgtcatggagtaccaccaagccacaggcactcttagtgcccacttcaggaatatgtcc
ctgaaacgaattaagaggtcagaccgtcgtggggcagagtcagtgacagaagaaaaattt
acaatcctgtttgaatcccagttcagtgttggtggaaatgagctggtttttcaagtcaag
accctgtccctgccagtggtggtgatcgttcatggcagccaggacaacaatgcgacagcc
accgttctctgggacaatgcttttgcagagcctggcagggtgccatttgccgtgcctgac
aaagtgctgtggccacagctgtgtgaggcgctcaacatgaaattcaaggccgaagtgcag
agcaaccggggcctgaccaaggagaaccttgtgttcctggcgcagaaactgttcaacaac
agcagcagccacctggaggactacagcggcctgtctgtgtcctggtcccagttcaacagg
gagaatttaccaggacggaattacactttctggcagtggtttgacggtgtgatggaagtg
ttaaaaaaacatctcaagcctcattggaatgatggggccattttggggtttgtaaacaag
caacaggcccatgacctactcattaacaagccagatgggaccttcctgctgagattcagt
gactcagaaattggcggcatcaccattgcttggaagtttgattctcaggaaagaatgttt
tggaatctgatgccttttaccaccagagacttctccattcggtccctagccgaccgcttg
ggagacttgaattaccttatctacgtgtttcctgatcggccgaaagatgaagtatactcc
aaatactacacaccagttccctgcgagtctgctactgctaaagccgttgacggatacgtg
aagccacagatcaagcaagtggtccctgagtttgtgaacgcatctgcagatgccgggagc
ggcagtgccacgtacatggaccaggccccctccccagctgtgtgcccccaggctcactat
aacatgtacccacagaaccctgattcagtccttgacaccgatggggactttgatctggag
gacacaatggacgtggcgcggcgtgtggaggagctcctgggccggccaatggacagtcag
tggatcccacacgcacagtcgtga

DBGET integrated database retrieval system