KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680950
Entry
104680950         CDS       T03989                                 

Gene name
NLRP4
Definition
(RefSeq) LOW QUALITY PROTEIN: NACHT, LRR and PYD domains-containing protein 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104680950 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rro04054]
    104680950 (NLRP4)
Membrane trafficking [BR:rro04131]
 Autophagy
  Other autophagy associated proteins
   Others
    104680950 (NLRP4)
Pattern recognition receptors [BR:rro04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   104680950 (NLRP4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 AAA_22 VirE DAP3 AAA_14
Other DBs
NCBI-GeneID: 104680950
NCBI-ProteinID: XP_010385358
LinkDB
Position
12
AA seq 1001 aa
MAASFFSDFGLMWYLEELKKEEFRKFKEHLKQMTLHLELKRIPWTEVKKASREELANLLI
KHYEEQQAWNITLRIFQKMDRKDLCMKVMRERTGYTQTYQAHAKQKFSRLWSSKSVTEIH
LYFQAEVRQEECEHLDHLFAPTETGKQPRTVVIQGPQGIGKTTLLIKLLMAWSDNKIFRD
RFLYTFYFCCRELRELPATSLADLISREWPDPAAPITEIVSQPERLLFVIDSFEELQGGL
NEPDSALCHDVMEKRPVQVLLSSLLRRKMLPEASLLVAVQPMCPKELRDRVAISEIYEPR
GFNESDRLVYFCCFFKDPKRALEAFNLVRESEQLFSICQIPLLCWILCTSLKQEMQKGKD
LTVTCQSTTSVYSSFIFNLFTPEGAEGPTPQSQCQLKALCSLAAEGMWTDTFEFREDDLR
RNGVVDTDIPALLGTKVLLKYGERESSYVFLHACVQEFCAALFYLLKSHLDHPHPAVRCV
QELLIAHFEKTRRAHWIFLGCFLTGLLNKQEQQKLDAFFGFQLSQEIKQQLHQCLKSLGE
HGDPQGQVDSLAIFYCLFEMQDPAFVKQAVNLLHKADFHIIDNADLVVSAYCLKYCSSLR
KLSFSVQNVFKKEDEHSSTSDYSLVCWHHICSVLTTSGHLTELQVQDSTLSESTFVTWCN
QLRHPSCRLQRLGINNVSFSGPSGQLFEVLFYQPDLKYLSFTLTKLSRDDVRSLCDALNY
PAGNVKELALVNCFLSPIDCEVLAFLLTNNKKLTYLNVSCNHLDTGLPLLCEALCNPDTV
LVYLMLAYCHLSEQCCEYISEMLLHNKSVRYLDLGANVLKDEGLKTLCEALKRPDCRLDS
LCLVKCFITAAGCEDLASALISNQNLKILQIGCNEIGDVGVKLLCGALMRPDCHLEILGL
EECGLTSTCCKDLASVLTSSKTLQQLNLTLNALDYAGVVVLCEALRHPECALQVLGLRKT
DFDEETQALLMAEEERNPNLTITDDCDTITRVESDCEEPGL
NT seq 3006 nt   +upstreamnt  +downstreamnt
atggcagcctctttcttctctgattttggtcttatgtggtatctagaggagctcaaaaag
gaggagttcaggaaatttaaggaacacctcaagcaaatgactttgcatcttgaactcaag
cggattccctggactgaggtcaaaaaagcatcccgggaagaacttgcaaacctcttgatc
aagcactatgaagaacaacaagcttggaacataaccttaagaatctttcaaaagatggat
agaaaggatctctgcatgaaggtcatgagggagagaacaggatacacacaaacctatcaa
gctcatgcaaagcagaaattcagccgcttatggtccagcaagtctgtcactgagattcac
ctgtacttccaggcggaagtcaggcaagaagaatgtgaacatttggaccacctttttgct
cccacggaaactgggaaacagccgcgtacggtggtcattcagggaccgcaaggaattggg
aaaacgacactcctgattaagctgctgatggcctggtcagacaacaagatctttcgggac
aggttcctgtacactttctatttctgctgcagagaactgagggagttgccagcaacgagc
ttggcggacctgatttccagagagtggcccgaccccgctgccccgataacagagatcgtg
tctcagccggagagactcttgtttgtcatcgacagcttcgaagagctgcagggcggcttg
aacgaacccgactcggctctgtgccacgacgtgatggagaaacggccggtgcaggtgctt
ctgagcagtttgctgaggaggaagatgctcccggaggcctccctgctcgtggccgtccaa
cccatgtgcccgaaggagctccgggatcgggtggcgatctcagaaatctacgagccccgg
ggattcaatgagagcgatcggttagtgtatttttgctgtttctttaaagacccgaaaaga
gccctggaagcctttaatcttgtaagagaaagtgagcaactgttttccatatgccaaatc
ccgctcctctgctggatcctgtgtacttctctgaagcaagagatgcagaaaggaaaagac
ctgaccgtgacctgccagagcactacctctgtgtactcctctttcatctttaacttgttc
acacccgagggtgccgagggtcccactccgcaaagccagtgccagctgaaggccctgtgc
tccctggctgcagagggcatgtggacggacacgtttgagtttcgtgaagacgacctccgg
agaaatggggttgttgacactgacatccctgcactgctgggcaccaaggttctcctgaag
tacggggagcgtgagagctcctacgtgttcctccacgcgtgtgtccaggagttctgtgct
gccttgttctatttgctcaagagccaccttgatcatcctcacccggccgtgagatgtgta
caggaattgctaattgcccattttgaaaaaacaaggagggcacattggatttttctgggg
tgttttctaactggccttttaaataaacaggaacaacagaaactggacgcgttttttggc
ttccagctgtcccaagagataaagcagcaacttcaccagtgcctgaagagcttaggggag
catggtgatcctcagggacaggtggattccttggcgatattttactgtctctttgagatg
caggatcctgcctttgtaaagcaggcagtgaacctcctccacaaagctgactttcatatt
attgacaacgcagacctggtggtttctgcctactgcttaaaatactgctccagtttgagg
aaactctctttttccgttcaaaatgtctttaagaaagaggatgaacacagctctacgtcg
gattacagcctcgtctgttggcatcacatctgctctgtgctcactaccagtgggcacctc
acagagctgcaggtacaggacagcaccctcagcgagtcgacctttgtgacctggtgtaac
cagctgaggcatcccagctgtcgtcttcagaggctcggaataaataatgtttccttttct
ggtccgagtggtcagctctttgaggtgcttttttatcagccagacttgaaatacctgagc
ttcaccctcacgaaactctctcgtgatgacgtcaggtccctctgtgacgccttgaactac
ccagcgggcaacgtaaaagagctagcgctggtaaattgtttcctctcacccatcgattgt
gaagtccttgccttccttctaaccaacaacaagaagctgacgtatctgaatgtgtcctgc
aaccacttagacacaggcttgcctcttctgtgtgaagcgctgtgcaacccagacacggtc
ctggtatacctgatgctggcttactgccacctcagtgaacagtgctgcgaatacatctct
gaaatgcttctgcataacaagagcgtgcgctatctagacctcggcgccaatgtcctgaag
gacgaaggactgaagaccctctgcgaggccttgaaacgcccagactgccgcctggattcg
ctgtgtttggtaaaatgttttatcactgctgctggctgtgaagacctcgcctctgctctc
atcagcaatcaaaacctgaagattctgcaaattgggtgcaatgaaattggagatgtgggc
gtgaagctgttgtgtggggctctgatgcgtccggattgccatttagagattcttgggttg
gaagaatgtgggttaacgagcacctgctgtaaagatcttgcgtctgttctcaccagcagt
aagaccctgcagcagctcaacctgaccttgaacgccttggactacgcaggggtggttgtg
ctctgtgaggccttgagacacccagagtgcgccctgcaggtgctcgggctgagaaaaact
gattttgatgaggaaacccaggcacttctgatggctgaggaagagagaaatcctaacctg
accatcacagacgactgtgacacaattacaagggtagaatctgattgcgaggaacctggg
ctctga

DBGET integrated database retrieval system