KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104680990
Entry
104680990         CDS       T03989                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro04012  ErbB signaling pathway
rro04062  Chemokine signaling pathway
rro04110  Cell cycle
rro04150  mTOR signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04310  Wnt signaling pathway
rro04340  Hedgehog signaling pathway
rro04360  Axon guidance
rro04390  Hippo signaling pathway
rro04510  Focal adhesion
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04657  IL-17 signaling pathway
rro04660  T cell receptor signaling pathway
rro04662  B cell receptor signaling pathway
rro04722  Neurotrophin signaling pathway
rro04728  Dopaminergic synapse
rro04910  Insulin signaling pathway
rro04916  Melanogenesis
rro04917  Prolactin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04931  Insulin resistance
rro04932  Non-alcoholic fatty liver disease
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro05010  Alzheimer disease
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05135  Yersinia infection
rro05160  Hepatitis C
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05213  Endometrial cancer
rro05215  Prostate cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104680990 (GSK3B)
   04310 Wnt signaling pathway
    104680990 (GSK3B)
   04340 Hedgehog signaling pathway
    104680990 (GSK3B)
   04390 Hippo signaling pathway
    104680990 (GSK3B)
   04151 PI3K-Akt signaling pathway
    104680990 (GSK3B)
   04150 mTOR signaling pathway
    104680990 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104680990 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104680990 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    104680990 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    104680990 (GSK3B)
   04657 IL-17 signaling pathway
    104680990 (GSK3B)
   04662 B cell receptor signaling pathway
    104680990 (GSK3B)
   04062 Chemokine signaling pathway
    104680990 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104680990 (GSK3B)
   04917 Prolactin signaling pathway
    104680990 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    104680990 (GSK3B)
   04919 Thyroid hormone signaling pathway
    104680990 (GSK3B)
   04916 Melanogenesis
    104680990 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    104680990 (GSK3B)
   04722 Neurotrophin signaling pathway
    104680990 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    104680990 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104680990 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104680990 (GSK3B)
   05225 Hepatocellular carcinoma
    104680990 (GSK3B)
   05226 Gastric cancer
    104680990 (GSK3B)
   05217 Basal cell carcinoma
    104680990 (GSK3B)
   05215 Prostate cancer
    104680990 (GSK3B)
   05213 Endometrial cancer
    104680990 (GSK3B)
   05224 Breast cancer
    104680990 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104680990 (GSK3B)
   05020 Prion disease
    104680990 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    104680990 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104680990 (GSK3B)
   04931 Insulin resistance
    104680990 (GSK3B)
   04934 Cushing syndrome
    104680990 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104680990 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    104680990 (GSK3B)
   05162 Measles
    104680990 (GSK3B)
   05163 Human cytomegalovirus infection
    104680990 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104680990 (GSK3B)
   05165 Human papillomavirus infection
    104680990 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104680990 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104680990 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rro03036]
    104680990 (GSK3B)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     104680990 (GSK3B)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   104680990 (GSK3B)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104680990 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 104680990
NCBI-ProteinID: XP_030797458
LinkDB
Position
1
AA seq 433 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQ
TNNAASASASNST
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccggtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggatggcagcaaggtgaccacagtg
gtggcaactcctgggcagggtccagacaggccacaagaagtcagctatacagacactaaa
gtgattggaaatggatcatttggtgtggtatatcaagccaaactttgtgattcaggagaa
ctggtcgccatcaagaaagtattgcaggacaagagatttaagaaccgagagctccagatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactccagtggt
gagaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatttatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatctgccatcgg
gatattaaaccacagaacctcttgttggatcctgatacagccgtattaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgctggctgtgtgttggctgagctgttactaggacaaccaatatttccaggggat
agtggtgtggatcagttggtggaaataatcaaggtcctgggaactccaacaagggagcaa
atcagagaaatgaacccaaactacacagaatttaaattccctcaaattaaggcacatcct
tggacgaaggattcgtcaggaacaggacatttcacctcaggagtgcgggtcttccgaccc
cgaactccaccagaggcaattgcactgtgtagccgtctgctggagtatacgccaactgcc
cgactaacaccactggaagcttgtgcacattcattttttgatgaattacgggacccaaat
gtcaaactaccaaatgggcgagacacacctgcactcttcaacttcaccactcaagaactg
tcaagtaatccacctctggctaccatccttattcctcctcatgctcggattcaagcagct
gcttcaactcccacaaatgccacagcagcctcagatgctaatactggagaccgtggacag
accaataatgctgcttctgcatcagcttccaactccacctga

DBGET integrated database retrieval system