KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104681576
Entry
104681576         CDS       T03989                                 

Gene name
HGF
Definition
(RefSeq) hepatocyte growth factor isoform X1
  KO
K05460  hepatocyte growth factor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro05144  Malaria
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05211  Renal cell carcinoma
rro05218  Melanoma
rro05223  Non-small cell lung cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104681576 (HGF)
   04014 Ras signaling pathway
    104681576 (HGF)
   04015 Rap1 signaling pathway
    104681576 (HGF)
   04020 Calcium signaling pathway
    104681576 (HGF)
   04151 PI3K-Akt signaling pathway
    104681576 (HGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104681576 (HGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104681576 (HGF)
   05205 Proteoglycans in cancer
    104681576 (HGF)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104681576 (HGF)
   05226 Gastric cancer
    104681576 (HGF)
   05218 Melanoma
    104681576 (HGF)
   05211 Renal cell carcinoma
    104681576 (HGF)
   05223 Non-small cell lung cancer
    104681576 (HGF)
  09174 Infectious disease: parasitic
   05144 Malaria
    104681576 (HGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104681576 (HGF)
Cytokines and growth factors [BR:rro04052]
 Growth factors
  Growth factors (RTK binding)
   104681576 (HGF)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   104681576 (HGF)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986
Other DBs
NCBI-GeneID: 104681576
NCBI-ProteinID: XP_010386218
UniProt: A0A2K6NWB3
LinkDB
Position
6
AA seq 788 aa
MVLCLCLDLAIGLSLAPPCLTRIGATGIWSSSFQIEAGLRPGDLFFASPPEGSASPSSST
MWVTKLLPALLLQHILLHLLLLPIAIPYAEGHKKRRNTIHEFKKSAKTTLIKIDPALKIK
TKKVNTADQCANRCTRNNGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKSCQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTVNDTDVPM
ETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGS
ESPWCFTTDPNIRVGYCSQIPNCDMSNGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNME
DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTRTNVGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRD
LKDYEAWLGIHDVHGRGDEKRKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLP
NYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAG
AEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKII
LTYKVPQS
NT seq 2367 nt   +upstreamnt  +downstreamnt
atggtcctctgcctgtgccttgatttagctattgggctcagccttgctcctccctgcctt
actcggataggagccactgggatctggagctccagcttccaaattgaagctggcctcagg
ccaggtgaccttttctttgcatctcctccagagggatccgccagcccgtccagcagcacc
atgtgggtgaccaaactcctgccagccctgctgctgcagcatattctcctgcatctcctc
ctgctccccatcgccatcccctatgcagagggacataagaaaagaagaaatacaattcat
gaattcaaaaaatcagcaaagactaccctaatcaaaatagatccagcactgaagataaaa
accaaaaaagtgaatactgcagaccaatgtgctaatagatgtactaggaataatggactt
ccattcacttgcaaggcctttgtttttgataaagcaagaaaacaatgcctgtggttcccc
ttcaatagcatgtcaagtggagtgaagaaagaatttggccatgaatttgacctctatgaa
aacaaagactacattagaaactgcatcattggtaaaggacgcagctacaagggaacagta
tctatcactaagagtggcatcaaatgtcagccctggagttccatgataccacatgaacac
agctttttgccttcgagctatcggggtaaagacctacaggaaaactactgtcgaaatcct
cgaggggaagaagggggaccctggtgtttcacaagcaatccagaggtacgctacgaagtc
tgtgacattcctcagtgttcagaagttgaatgcatgacctgcaatggggagagttatcga
ggtctcatggatcatacagaatcaggcaagagttgtcagcgctgggatcatcagacacca
caccggcacaaattcttgcctgaaagatatcccgacaagggctttgatgataattattgc
cgcaatcccgatggccagccgaggccatggtgctatactcttgaccctcacacccgctgg
gagtactgtgcaattaaaacatgcgctgacaatactgtaaatgatactgatgttcctatg
gaaacaactgaatgcatccaaggtcaaggagaaggctacaggggcactgtcaataccatt
tggaatggaattccatgtcagcgttgggattctcagtatcctcacgagcatgacatgact
cctgaaaatttcaagtgcaaggacctacgagaaaattactgccgaaatccagatgggtct
gaatcaccctggtgttttaccactgatccaaacatccgagttggttactgctcccaaatt
ccaaactgtgatatgtcaaatggacaagattgttatcgtgggaatggcaaaaattatatg
ggcaacttatcccaaacaagatctggactaacatgttcaatgtgggacaagaacatggaa
gacttacaccgtcatatcttctgggaaccagatgcaagtaagttgaatgagaattactgc
cgaaatccggatgatgatgctcatggaccctggtgctacaccggaaatccactcattcct
tgggattattgccctatttctcgttgtgaaggtgataccacacctacaatagtcaattta
gaccatcctgtaatatcttgcgccaaaacgaaacagttgcgagttgtaaatgggattcca
acacgaacaaatgtaggatggatggttagtttgagatacagaaataaacatatctgcgga
ggatcattgataaaggaaagttgggttcttactgcacgacagtgtttcccttctcgagac
ttgaaagattatgaagcttggcttggaattcatgatgtccatggaagaggagatgagaaa
cgcaaacaggttctcaatgtttcccagctggtatatggccctgaaggatcagatctggtc
ttaatgaagcttgctaggcctgctgtcctggatgattttgttagtacaattgatttacct
aattatggatgcacaattcctgaaaagaccagttgcagtgtttatggctggggctacact
ggattgatcaactatgatggtctattacgagtggcacatctctatataatgggaaatgag
aaatgcagccagcaccaccgagggaaggtgactctgaatgagtctgaaatatgtgctggg
gctgagaagattggatcaggaccatgtgagggggattatggtggcccacttgtttgtgag
caacataaaatgagaatggttcttggtgtcattgttcccggccgtggatgtgccattcca
aatcgtcctggtatttttgtccgagtagcatattatgcaaaatggatacacaaaattatt
ttaacatataaggtaccacagtcatag

DBGET integrated database retrieval system