KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104681728
Entry
104681728         CDS       T03989                                 

Gene name
EGR1
Definition
(RefSeq) early growth response protein 1
  KO
K09203  early growth response protein 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04371  Apelin signaling pathway
rro04912  GnRH signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro05020  Prion disease
rro05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104681728 (EGR1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104681728 (EGR1)
   04928 Parathyroid hormone synthesis, secretion and action
    104681728 (EGR1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    104681728 (EGR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104681728 (EGR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104681728 (EGR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104681728 (EGR1)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    104681728 (EGR1)
SSDB
Motif
Pfam: DUF3432 DUF3446 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2HC_2 Cornifin Zf_RING zf-BED zf-H2C2_5
Other DBs
NCBI-GeneID: 104681728
NCBI-ProteinID: XP_010386403
UniProt: A0A2K6RNT3
LinkDB
Position
3
AA seq 541 aa
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGS
NSSSSSGGGGGGGGGSSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETSYP
SQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAASSS
SASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAYPA
AKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSGSQ
DLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIH
TGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK
DKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTY
PSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEI
C
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggccgcggccaaggccgagatgcagctgatgtccccgctgcagatctctgacccgttc
ggatcctttcctcactcgcccaccatggacaactaccctaagctggaggagatgatgctg
ctgagcaacggggctccccagttcctcggcgccgccggggcccctgagggcagcggcagt
aacagcagcagcagcagcgggggcggtggaggcggcgggggcggcagcagcagcagcagc
agcagcaccttcaaccctcaggcggacacgggcgagcagccctacgagcacctgaccgca
gagtcttttcctgacatctctctgaacaacgagaaggtgctggtggagacaagttacccc
agccaaaccactcgactgccccccatcacctatactggccgcttttccctggaacctgca
cccaacagtggcaacaccttgtggcccgagcccctcttcagcttggtcagtggcctcgtg
agcatgaccaacccaccagcctcctcgtcctcagcaccatctccagcggcctcctcctcc
tccgcctcccagagcccacccctgagctgtgcagtgccatccaacgacagcagtcccatt
tactcagcggcacccaccttccccacgccgaacactgacattttccctgagccacaaagc
caggccttcccgggctcagcagggacagcgctccagtacccgcctcctgcctaccctgcc
gccaagggtggcttccaggttccaatgatccccgactacctgtttccacagcagcagggg
gatctgggcctgggtaccccagaccagaagcccttccagggcctggaaagccgcacccag
cagccttcgctcacccccctgtctactatcaaggcctttgccactcagtcgggctcccag
gacctgaaggccctcaataccagttaccagtcccagctcatcaaacccagccgaatgcgc
aagtaccccaaccggcccagcaagacgcccccccacgaacgcccttacgcttgcccggtg
gagtcctgtgatcgccgcttctcccgctctgacgagctcacccgccacatccgcatccac
acaggccagaagcccttccagtgccgcatctgcatgcgcaacttcagccgcagcgaccac
ctcaccacccacatccgtacccacacgggcgagaagcccttcgcctgcgacatctgtggg
agaaagtttgccaggagcgatgaacgcaagaggcataccaagatccacttgcggcagaag
gacaagaaagcagacaaaagtgttgtggcctcttcggccacctcctctctctcttcctac
ccatccccggttgctacctcttacccatccccggttactacctcttatccatccccggcc
accacctcatacccgtcccctgtgcccacctccttctcctctcccggctcctcaacctac
ccatcccctgtgcacagtggcttcccctccccgtcggtggccaccacgtactcctccgtt
ccccctgccttcccggcccaggtcagcagcttcccttcctcagctgtcaccaactccttt
agcgcctccacagggctttcggacatgacagcaaccttttctcccaggacaattgaaatt
tgctaa

DBGET integrated database retrieval system