KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104681756
Entry
104681756         CDS       T03989                                 

Gene name
HBEGF
Definition
(RefSeq) proheparin-binding EGF-like growth factor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04012  ErbB signaling pathway
rro04912  GnRH signaling pathway
rro04915  Estrogen signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro05171  Coronavirus disease - COVID-19
rro05205  Proteoglycans in cancer
rro05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104681756 (HBEGF)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104681756 (HBEGF)
   04915 Estrogen signaling pathway
    104681756 (HBEGF)
   04928 Parathyroid hormone synthesis, secretion and action
    104681756 (HBEGF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104681756 (HBEGF)
  09162 Cancer: specific types
   05219 Bladder cancer
    104681756 (HBEGF)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    104681756 (HBEGF)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104681756 (HBEGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104681756 (HBEGF)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   104681756 (HBEGF)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 104681756
NCBI-ProteinID: XP_010386435
UniProt: A0A2K6P4R0
LinkDB
Position
3
AA seq 208 aa
MKLLPSVVPKLLLAAVLSALVTGESLEQLRRGLAAGTSNLDPSTGSTDQLLPLGGGRDRK
VRDLQEADLDLLRVTLSSKPQALATPSKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTNSH
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagctgctgccgtcggtggtgccgaagctccttctggctgcagttctttcggcactg
gtgactggcgagagcctggagcagcttcggagagggctagctgctggaaccagcaacctg
gacccttccactggatccacggaccagctgctacccctaggaggcggccgggaccggaaa
gtccgtgacttgcaagaggcagatctggaccttttgagagtcactttatcctccaagcca
caagcactggccacaccaagcaaggaggagcacgggaaaagaaagaagaaaggcaaggga
ctagggaagaagagggacccatgtcttcggaagtacaaggacttctgcatccacggagaa
tgcaaatatgtgaaggagctccgggctccctcctgcatctgccacccgggttaccatgga
gagaggtgtcatgggctgagcctcccagtggaaaatcgcttatatacctatgaccataca
actatcctggccgtggtggccgtggtgctgtcatctgtctgtctgctggtcatcgtgggg
cttctcatgtttaggtaccataggagaggtggttatgatgtggaaaacgaagagaaagtg
aagttgggcatgactaattcccactga

DBGET integrated database retrieval system