KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104681837
Entry
104681837         CDS       T03989                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04390  Hippo signaling pathway
rro04810  Regulation of actin cytoskeleton
rro05200  Pathways in cancer
rro05218  Melanoma
rro05224  Breast cancer
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104681837 (FGF1)
   04014 Ras signaling pathway
    104681837 (FGF1)
   04015 Rap1 signaling pathway
    104681837 (FGF1)
   04390 Hippo signaling pathway
    104681837 (FGF1)
   04151 PI3K-Akt signaling pathway
    104681837 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104681837 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104681837 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    104681837 (FGF1)
   05218 Melanoma
    104681837 (FGF1)
   05224 Breast cancer
    104681837 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104681837 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104681837 (FGF1)
Cytokines and growth factors [BR:rro04052]
 Growth factors
  Growth factors (RTK binding)
   104681837 (FGF1)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   104681837 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 104681837
NCBI-ProteinID: XP_010386569
UniProt: A0A2K6PSJ7
LinkDB
Position
3
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcaccacgttcacagccctgaccgagaagtttaatctgcctcca
gggaattacaagaagcccaaactcctctactgtagcaacgggggccacttcttgaggatc
cttccagatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggcttttatacggctcacagacaccaaatgaggaatgtttgttc
ctggaaaggctggaggagaaccattacaacacctatatatccaagaagcacgcagagaag
aattggtttgttggcctcaagaagaatggaagctgcaaacgcggtcctcggactcactat
ggccagaaagcaatcttgtttcttcccctgccagtctcttctgattaa

DBGET integrated database retrieval system