KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682060
Entry
104682060         CDS       T03989                                 

Gene name
RAD51
Definition
(RefSeq) DNA repair protein RAD51 homolog 1 isoform X1
  KO
K04482  DNA repair protein RAD51
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro03440  Homologous recombination
rro03460  Fanconi anemia pathway
rro05200  Pathways in cancer
rro05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    104682060 (RAD51)
   03460 Fanconi anemia pathway
    104682060 (RAD51)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104682060 (RAD51)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104682060 (RAD51)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104682060 (RAD51)
   04121 Ubiquitin system [BR:rro04121]
    104682060 (RAD51)
   03400 DNA repair and recombination proteins [BR:rro03400]
    104682060 (RAD51)
Membrane trafficking [BR:rro04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    104682060 (RAD51)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    104682060 (RAD51)
DNA repair and recombination proteins [BR:rro03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     104682060 (RAD51)
    RecA family proteins
     104682060 (RAD51)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     104682060 (RAD51)
SSDB
Motif
Pfam: Rad51 AAA_25 RecA HHH_5 ATPase HhH-GPD HHH ssDNA_TraI_N
Other DBs
NCBI-GeneID: 104682060
NCBI-ProteinID: XP_010386841
UniProt: A0A2K6NAH8
LinkDB
Position
5
AA seq 339 aa
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcaatgcagatgcagcttgaagcaaatgcagatacttcagtggaagaagaaagcttt
ggcccacaacccatttcacggttagagcagtgtggcataaatgccaacgatgtgaagaaa
ttggaagaagctggattccatactgtggaggctgttgcctatgcaccaaagaaggagcta
ataaatattaagggaattagtgaagccaaagctgataaaattctggctgaggcagctaaa
ttagttccaatgggtttcaccactgcaactgaattccaccaaaggcggtcagagatcata
cagattactactggctccaaagagcttgacaaactacttcaaggtggaattgagactgga
tctatcacagaaatgtttggagaattccgaactgggaagacccagatctgtcatacacta
gctgtcacctgccagcttcccattgaccggggtggaggtgaaggaaaggccatgtacatt
gacaccgagggtacctttaggccagaacgactgctggcagtggctgagaggtatggtctg
tctggcagtgatgtcctggataatgtagcatatgctcgagcgttcaacacagaccatcag
acccagctcctttatcaagcatcagccatgatggtagaatctaggtatgcactgcttatt
gtagacagtgccaccgctctttacagaacggactactcaggtcgaggtgagctttcagcc
aggcagatgcacttggccaggtttctgcggatgcttctgcgacttgctgatgagtttggt
gtagcagtggtaatcactaatcaggtggtagcccaagtggatggagcagccatgtttgct
gctgatcccaaaaaacctattggaggaaatatcatcgcccatgcatcaacaaccagattg
tatctgaggaaaggaagaggggaaaccagaatctgcaaaatctacgactctccctgtctt
cctgaagctgaagctatgtttgccatcaatgcagatggagtgggagatgccaaagactga

DBGET integrated database retrieval system