KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682248
Entry
104682248         CDS       T03989                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2 isoform X1
  KO
K02161  apoptosis regulator Bcl-2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro01524  Platinum drug resistance
rro04064  NF-kappa B signaling pathway
rro04066  HIF-1 signaling pathway
rro04071  Sphingolipid signaling pathway
rro04115  p53 signaling pathway
rro04140  Autophagy - animal
rro04141  Protein processing in endoplasmic reticulum
rro04151  PI3K-Akt signaling pathway
rro04210  Apoptosis
rro04215  Apoptosis - multiple species
rro04217  Necroptosis
rro04261  Adrenergic signaling in cardiomyocytes
rro04340  Hedgehog signaling pathway
rro04510  Focal adhesion
rro04621  NOD-like receptor signaling pathway
rro04630  JAK-STAT signaling pathway
rro04722  Neurotrophin signaling pathway
rro04725  Cholinergic synapse
rro04915  Estrogen signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro05014  Amyotrophic lateral sclerosis
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05161  Hepatitis B
rro05162  Measles
rro05168  Herpes simplex virus 1 infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05215  Prostate cancer
rro05222  Small cell lung cancer
rro05226  Gastric cancer
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104682248 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    104682248 (BCL2)
   04630 JAK-STAT signaling pathway
    104682248 (BCL2)
   04064 NF-kappa B signaling pathway
    104682248 (BCL2)
   04066 HIF-1 signaling pathway
    104682248 (BCL2)
   04071 Sphingolipid signaling pathway
    104682248 (BCL2)
   04151 PI3K-Akt signaling pathway
    104682248 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104682248 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    104682248 (BCL2)
   04215 Apoptosis - multiple species
    104682248 (BCL2)
   04217 Necroptosis
    104682248 (BCL2)
   04115 p53 signaling pathway
    104682248 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104682248 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104682248 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    104682248 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    104682248 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104682248 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    104682248 (BCL2)
   04722 Neurotrophin signaling pathway
    104682248 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104682248 (BCL2)
   05206 MicroRNAs in cancer
    104682248 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104682248 (BCL2)
   05226 Gastric cancer
    104682248 (BCL2)
   05215 Prostate cancer
    104682248 (BCL2)
   05222 Small cell lung cancer
    104682248 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    104682248 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    104682248 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104682248 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104682248 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104682248 (BCL2)
   05152 Tuberculosis
    104682248 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104682248 (BCL2)
   05161 Hepatitis B
    104682248 (BCL2)
   05162 Measles
    104682248 (BCL2)
   05168 Herpes simplex virus 1 infection
    104682248 (BCL2)
   05169 Epstein-Barr virus infection
    104682248 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104682248 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104682248 (BCL2)
   01524 Platinum drug resistance
    104682248 (BCL2)
   01522 Endocrine resistance
    104682248 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104682248 (BCL2)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104682248 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 104682248
NCBI-ProteinID: XP_030781897
LinkDB
Position
21
AA seq 212 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAATPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLPTPAAPAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWKKSVELFHHNLWMADVV
NT seq 639 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtacgataaccgggagatagtgatgaagtacatccac
tataagctgtcgcagaggggctacgagtgggatgcgggagatgtgggcgccgcgacccct
ggggccgcccccgcaccgggcatcttctcctcccagcccgggcacacgccccatcccgcc
gcgtcccgggacccggtcgccaggacctcgccgctgccgaccccggctgcccccgccgcc
gccgcggggcctgcgctcagcccggtgccacctgtggtccacctgaccctccgccaggcc
ggtgacgacttctcccgccgctaccgccgcgacttcgccgagatgtccagccagctgcac
ctgacgcccttcaccgcgcggggacgctttgccacggtggtggaggagctcttcagggac
ggggtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggag
agcgtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgactgagtac
ctgaaccggcacctgcacacttggatccaggataacggaggctggaagaaatctgtagaa
ctgtttcatcacaacctgtggatggctgacgtagtttga

DBGET integrated database retrieval system