KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682344
Entry
104682344         CDS       T03989                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro04110  Cell cycle
rro04115  p53 signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04218  Cellular senescence
rro04530  Tight junction
rro04660  T cell receptor signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04934  Cushing syndrome
rro05160  Hepatitis C
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05212  Pancreatic cancer
rro05214  Glioma
rro05218  Melanoma
rro05219  Bladder cancer
rro05220  Chronic myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104682344 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104682344 (CDK4)
   04115 p53 signaling pathway
    104682344 (CDK4)
   04218 Cellular senescence
    104682344 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104682344 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    104682344 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104682344 (CDK4)
   05203 Viral carcinogenesis
    104682344 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104682344 (CDK4)
   05225 Hepatocellular carcinoma
    104682344 (CDK4)
   05214 Glioma
    104682344 (CDK4)
   05220 Chronic myeloid leukemia
    104682344 (CDK4)
   05218 Melanoma
    104682344 (CDK4)
   05219 Bladder cancer
    104682344 (CDK4)
   05224 Breast cancer
    104682344 (CDK4)
   05222 Small cell lung cancer
    104682344 (CDK4)
   05223 Non-small cell lung cancer
    104682344 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104682344 (CDK4)
   04934 Cushing syndrome
    104682344 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104682344 (CDK4)
   05160 Hepatitis C
    104682344 (CDK4)
   05164 Influenza A
    104682344 (CDK4)
   05162 Measles
    104682344 (CDK4)
   05163 Human cytomegalovirus infection
    104682344 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104682344 (CDK4)
   05169 Epstein-Barr virus infection
    104682344 (CDK4)
   05165 Human papillomavirus infection
    104682344 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    104682344 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104682344 (CDK4)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     104682344 (CDK4)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CMGC group
  CDK family
   104682344 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 104682344
NCBI-ProteinID: XP_010387225
UniProt: A0A2K6P415
LinkDB
Position
10
AA seq 303 aa
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctacctctcgatatgagccagtggctgaaattggtgtcggtgcctatgggacagtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtcccc
aatggaggaggagctggaggaggccttcccatcagcacagttcgggaggtggccttactg
aggcgactggaggcttttgaacatcccaatgttgtccggctgatggacgtctgtgccaca
tcccgaactgaccgggagatcaaggtaaccctggtgtttgagcatgtagaccaagaccta
aggacgtatctggacaaggcacccccaccaggcttgccagccgagaccatcaaggatttg
atgcgccagtttctaagaggcctagatttccttcatgcaaattgcatcgttcaccgagat
ctgaagccagagaacattctggtgacaagtggtggaacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacccgtggttgttacgctctggtac
cgagctcccgaagttcttctgcagtccacatatgcaacacctgtggacatgtggagtgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttgggcaaaatctttgacctgattgggctgcctccagaggatgactggcctcga
gatgtatccctgccccgtggagcctttccccccagagggccccgcccagtacagtcggtg
gtacctgagatggaggagtcgggagcacagctgctgctggaaatgctgacttttaaccca
cacaagcgaatctctgcctttcgagctctgcagcactcttatctacataaggatgaaggt
aatccggagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682750
Entry
104682750         CDS       T03989                                 

Gene name
CDK6
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04110  Cell cycle
rro04115  p53 signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04218  Cellular senescence
rro04934  Cushing syndrome
rro05160  Hepatitis C
rro05162  Measles
rro05163  Human cytomegalovirus infection
rro05164  Influenza A
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05206  MicroRNAs in cancer
rro05212  Pancreatic cancer
rro05214  Glioma
rro05218  Melanoma
rro05220  Chronic myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    104682750 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104682750 (CDK6)
   04115 p53 signaling pathway
    104682750 (CDK6)
   04218 Cellular senescence
    104682750 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104682750 (CDK6)
   05206 MicroRNAs in cancer
    104682750 (CDK6)
   05203 Viral carcinogenesis
    104682750 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104682750 (CDK6)
   05225 Hepatocellular carcinoma
    104682750 (CDK6)
   05214 Glioma
    104682750 (CDK6)
   05220 Chronic myeloid leukemia
    104682750 (CDK6)
   05218 Melanoma
    104682750 (CDK6)
   05224 Breast cancer
    104682750 (CDK6)
   05222 Small cell lung cancer
    104682750 (CDK6)
   05223 Non-small cell lung cancer
    104682750 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104682750 (CDK6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    104682750 (CDK6)
   05164 Influenza A
    104682750 (CDK6)
   05162 Measles
    104682750 (CDK6)
   05163 Human cytomegalovirus infection
    104682750 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104682750 (CDK6)
   05169 Epstein-Barr virus infection
    104682750 (CDK6)
   05165 Human papillomavirus infection
    104682750 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104682750 (CDK6)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     104682750 (CDK6)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CMGC group
  CDK family
   104682750 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 104682750
NCBI-ProteinID: XP_010387789
UniProt: A0A2K6P4F4
LinkDB
Position
6
AA seq 326 aa
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacggcctgtgccgcgctgaccagcagtacgaatgcgtggcggagatcggg
gagggcgcctatgggaaggtgttcaaggcccgcgacttgaagaacggaggccgtttcgtg
gcgttgaagcgcgtgcgggtgcagacgggcgaggagggcatgccgctctctaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gatgtgtgcacagtgtcacgaacagacagagaaaccaaactaactttagtgtttgaacat
gttgatcaagacttgaccacttacttggataaagttccagagcctggagtgcccactgaa
accataaaggatatgatgtttcagcttctccgaggtctggactttcttcattcacaccga
gtagtgcatcgcgatctaaaaccacagaacattctggtgaccagcagcggacaaataaaa
ctcgctgacttcggccttgcccgcatctatagtttccagatggctcttacctcagtggtc
gtcacactgtggtacagagctcccgaagtcttgctccagtccagctacgccacccccgtg
gatctatggagtgttggctgcatatttgcagaaatgtttcgtagaaagcctctttttcgt
ggaagttcagatgtcgatcaactaggaaaaatcttggacgtaattggactcccaggagaa
gaagactggcctagagatgttgcccttcccaggcaggcttttcattcaaaatctgcccaa
ccaattgagaagtttgtaacagatatcgatgaactaggcaaagatctacttctgaagtgt
ttgacatttaacccagccaaaagaatatcagcctacagtgccctgtctcacccatacttc
caggacctggagaggtgcaaagaaaacctggattcccacctgccgcccagccagaacacc
tcggagctgaatacagcctga

DBGET integrated database retrieval system