KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682421
Entry
104682421         CDS       T03989                                 

Gene name
EGF
Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04072  Phospholipase D signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04540  Gap junction
rro04630  JAK-STAT signaling pathway
rro04810  Regulation of actin cytoskeleton
rro05160  Hepatitis C
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05219  Bladder cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05226  Gastric cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104682421 (EGF)
   04012 ErbB signaling pathway
    104682421 (EGF)
   04014 Ras signaling pathway
    104682421 (EGF)
   04015 Rap1 signaling pathway
    104682421 (EGF)
   04630 JAK-STAT signaling pathway
    104682421 (EGF)
   04066 HIF-1 signaling pathway
    104682421 (EGF)
   04068 FoxO signaling pathway
    104682421 (EGF)
   04020 Calcium signaling pathway
    104682421 (EGF)
   04072 Phospholipase D signaling pathway
    104682421 (EGF)
   04151 PI3K-Akt signaling pathway
    104682421 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104682421 (EGF)
   04540 Gap junction
    104682421 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104682421 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104682421 (EGF)
   05231 Choline metabolism in cancer
    104682421 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104682421 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104682421 (EGF)
   05212 Pancreatic cancer
    104682421 (EGF)
   05226 Gastric cancer
    104682421 (EGF)
   05214 Glioma
    104682421 (EGF)
   05218 Melanoma
    104682421 (EGF)
   05219 Bladder cancer
    104682421 (EGF)
   05215 Prostate cancer
    104682421 (EGF)
   05213 Endometrial cancer
    104682421 (EGF)
   05224 Breast cancer
    104682421 (EGF)
   05223 Non-small cell lung cancer
    104682421 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    104682421 (EGF)
   05165 Human papillomavirus infection
    104682421 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104682421 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104682421 (EGF)
Cytokines and growth factors [BR:rro04052]
 Growth factors
  Growth factors (RTK binding)
   104682421 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition EGF cEGF EGF_CA EGF_3 DUF5050
Other DBs
NCBI-GeneID: 104682421
NCBI-ProteinID: XP_010387372
LinkDB
Position
2
AA seq 1263 aa
MLLTLIILLPVVLKFSFVSLSAPQHWSCPEGTPAGHGNSTRVGPAPFLIFSHGNSIFRID
TEGTNYEPLVVDAGVSVIMDFHYKEKIIYWVDLERQLLQRVFLNGSRRERVCNIEKNVSG
MAINWINEEVIWSNQQEGIITVTDMKGNNSHVLLSALKYPANIAVDPVERFIFWSSEVAG
SLYRADLDGVEVKSLLETSEKITAVSLDVLDKRLFWIQYSREGSNSLICSCDYDGGSVRI
SKHPTQHNLFAMSLFGDHVFYSTWKTRTIWIANKHTGKDMVRINLHPSFVPPGELKVVHP
LAQPKAEDDAREREQKLHKSRKGNCSSTVCGQDAQSHLCTCAEGYTLSRDRKYCEGNDRK
YCEDVNECAFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPSNVSECSHDC
VLTSEDPLCFCPEGSVLERDGKTCSGCSSPDNGGCSQLCISLSPVSWECDCFPGYDLQLD
KKSCVASGPQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENKIYFAHTA
LKWIERANMDGSQRERLIEEGVDMPEGLAVDWIGRRFYWTDRGKMLLGIWLGLEKRGHHC
CPHSPTSSFHQDCVSVRGRILKTKKVACVRKSLIGRSDLNGKHPKIIIKENISQPRGIAV
HPTAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPNGITIDFLTDKLYWCDAKQSV
IEIANLDGSKRRRLTQNDVGHPFAIAVFEDYVWFSDWAMPSVIRVNKKTGKDRVRLQGSM
LKPSSLVVVHPLAKPGADPCLYQNGGCEHICKERLGTAWCLCREGFMKASDGKTCLALDG
HQLLAGGEVDLKNQVTPLDTLSKTRVSEDNITESQHMLVAEIMVSDQYDCAPVGCSTYAR
CVSEGDDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCQCSEGYQG
DGIHCLDIDECQLGVHSCGENANCTNTEGGYTCTCAGRLSEPGLICPDSTPPPHLREDDH
HYSVRNSDSGCPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELRHA
GHGQQQKVTVVAVCVVVLVVLLLLSLWGAHYYRTQKLLTKNPKNPSEESSRDARSRRPDD
SEDGMSSCPQPWFVVTKEHQDLRNGSQPVAGEDGQAADVGSVQPTSWRQEPQLRGVGPEQ
GCWIPVSSDKGSCPQVMERSFHMPSYGTQPLDGGVQKPHSFLSVNPLWQQRALDPPHQME
LTQ
NT seq 3792 nt   +upstreamnt  +downstreamnt
atgctgctcactcttatcattctgttgccagtagttttaaaatttagttttgttagtctc
tcagcaccgcagcactggagctgtcctgaaggtactcccgcaggacatgggaattctact
cgtgtgggtcctgcacccttcttaattttctcccacggaaatagtatctttaggattgac
acggaaggaaccaattatgagccattggtggtggatgctggtgtctcagtgatcatggat
tttcattataaagagaaaataatctattgggtggatttagaaagacaacttttgcaaaga
gtttttctgaatgggtcaaggcgagagagagtatgtaatatagagaaaaatgtttctgga
atggcaataaattggataaatgaagaagttatttggtcaaatcaacaggaaggaatcatt
acagtaacagatatgaaaggaaataattcccacgttcttttaagtgctttaaaatatcct
gcaaatatagcagttgatccagtagaaaggtttatattttggtcttcagaggtggctggc
agcctttacagagcagatcttgatggtgtggaagtgaagtctctgttagagacatcagag
aaaataacagctgtgtcattggatgtgcttgataagcggctgttttggattcagtacagc
agagaaggaagcaattctcttatttgctcctgtgattatgatggaggttctgtccgtatt
agtaaacatccaacacagcacaatttgtttgcaatgtccctttttggtgaccatgtcttc
tattcaacatggaaaacgaggacaatttggatagccaacaaacacactggaaaggatatg
gttagaattaacctccatccatcatttgtaccacctggtgaactgaaagtagtgcatcca
cttgcacagcccaaggcagaagatgatgctcgggagcgtgagcagaaacttcacaaatcg
aggaagggaaactgcagcagcactgtgtgtgggcaagacgcccagtcacacttgtgcacg
tgtgcagagggatacaccttaagtcgagaccggaagtactgtgaaggtaatgaccggaag
tactgtgaagatgttaatgaatgtgctttttggaatcatggctgtactcttgggtgtaaa
aacacccctggatcctattactgcacatgccctgtaggatttgttctgcttcctgatggg
aaacgatgtcatcaacttgtttcctgtccaagcaatgtgtctgaatgcagccatgactgt
gttctgacatcagaagatcccttatgtttctgtcctgaaggctcagtgcttgagagagat
gggaaaacatgtagcggttgttcctcacccgataatggtggatgtagccagctctgcatt
tctctcagcccagtatcctgggaatgtgattgctttcctgggtatgacctacaactggat
aaaaaaagctgtgtagcttcaggaccacaaccatttttgctgtttgccaattctcaagat
attcgacacatgcattttgatggaacagactatggaactctgctcagccagcagatggga
atggtttatgccctagatcatgaccctgtggaaaataagatatactttgcccatacagcc
ctgaagtggatagagagagctaatatggatggttcccagcgagaaaggcttattgaggaa
ggagtagatatgccagaaggtcttgctgtggactggattggccgtagattctattggaca
gacagaggaaaaatgttgctgggcatctggctgggattggagaaaagaggccaccactgc
tgtccacactcccccacttcctcctttcatcaagattgcgtctctgtgcgtgggaggatt
ttgaagaccaagaaagtagcctgtgttaggaaatctctgattggaaggagtgatttaaat
ggaaaacatcccaaaataatcattaaggagaacatctctcaaccacgaggaattgctgtt
catccaacggccaagagattattctggacggatacagggattaatccacgaattgaaagt
tcttccctccaaggccttggccgactggttatagccagctctgatctaatctggcccaat
ggaataacgattgacttcttaactgacaagttgtattggtgcgatgccaagcagtctgta
attgaaatagccaatctggatggttcaaaacgccgaagacttacccagaacgatgtaggt
cacccatttgctatagctgtgtttgaggattatgtgtggttctcagattgggctatgcct
tcagtaataagagtaaacaagaagactggcaaagatagagtacgtctccaaggcagcatg
ctgaagccctcctcactggttgtggttcatccactggcaaaaccaggagcagatccctgc
ttatatcaaaacggaggctgtgaacatatttgcaaagagaggcttggaactgcttggtgt
ttgtgtcgtgaaggttttatgaaagcctcagatgggaaaacgtgtctggctctggatggt
catcagctgttggcaggtggtgaagttgatctaaagaaccaggtaacaccattggacacc
ttatcgaagactagagtgtcagaagataacattacagaatctcaacacatgctagtggct
gaaatcatggtgtcagatcaatatgactgtgctcctgtgggatgcagcacatatgctcgg
tgtgtttcagagggagacgatgccacgtgtcagtgtttgaaaggatttgctggggatgga
aaactatgttctgatatagatgaatgtgagatgggtgtcccagtgtgcccccctgcctcc
tccaagtgcatcaacaccgaaggtggctatgtctgccagtgctcagaaggctaccaagga
gatgggattcactgtcttgatattgatgagtgccaactgggggtgcacagctgtggagag
aatgccaactgcacaaatacagagggtggctacacctgcacatgtgctggacgcctgtct
gaaccaggactgatttgccctgactctactccaccccctcacctcagggaagatgaccac
cactattctgtaagaaatagtgactctggatgtcccctgtcccacgatggatactgcctc
catgatggtgtgtgcatgtatattgaagcattggacaaatatgcatgcaactgtgttgtt
ggctacatcggggagcgatgtcagtaccgagacctgaagtggtgggaactgcgtcacgct
ggccacgggcagcagcagaaggtcaccgtggtggctgtctgcgtggtggtgcttgtcgtg
ctgctcctcctgagcctgtggggtgcccactactacaggactcagaagctgctaacgaaa
aatccaaagaatccttctgaggagtcaagcagagacgcgaggagtcgcaggcctgatgac
agtgaggatgggatgtcctcttgccctcaaccttggtttgtggttacaaaggaacaccaa
gacctcaggaatgggagtcaaccagtggctggtgaggatggccaggcagcagatgttggg
tcagtgcaaccaacttcatggaggcaggagccccagttacgtggagtgggcccagagcaa
ggctgctggattccagtatccagtgataagggctcctgtccccaggtaatggagcgaagt
tttcatatgccctcctatgggacacagccccttgatgggggtgtccagaagccccattct
ttcctatcagttaacccattatggcaacaaagggccctggacccaccacaccaaatggag
ctgactcagtga

DBGET integrated database retrieval system