KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682443
Entry
104682443         CDS       T03989                                 

Gene name
ARHGEF6
Definition
(RefSeq) rho guanine nucleotide exchange factor 6 isoform X1
  KO
K05729  Rho guanine nucleotide exchange factor 6
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04810  Regulation of actin cytoskeleton
rro05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104682443 (ARHGEF6)
 09160 Human Diseases
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104682443 (ARHGEF6)
Membrane trafficking [BR:rro04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    104682443 (ARHGEF6)
SSDB
Motif
Pfam: RhoGEF67_u2 betaPIX_CC RhoGEF CH SH3_2 SH3_9 RhoGEF67_u1 SH3_1 PH CAMSAP_CH Peptidase_C42 Nsp1_C
Other DBs
NCBI-GeneID: 104682443
NCBI-ProteinID: XP_030789589
LinkDB
Position
7
AA seq 780 aa
MNPEEQIVTWLISLGVLDSPKKTICDPEEFLKSSLKNGVVLCKLINRLMPGSVEKFCLDP
QTEADCINNINDFLKGCATLQVEVFDPDDLYSGVNFSKVLSTLLAVNKATEDQLSERPCG
RSSSLSTANNSQTNPQGAVSSTVSGLQRQSKTVEMTENGSHQLIVKARFNFKQTNEDELS
VCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERPLSPKAIKGFETAPLTKN
YYTVVLQNILDTEKEYAKELQSLLVTYLRPLQSNNNLSTVEVMSLLGNFEEVCTFQQTLC
QALEECSKFPENQQKVGGCLLSLMPHFKSMYLAYCANHPSAVNVLTQHSDELEQFMENQG
ASSPGILILTTSLSKPFMRLEKYVTLLQELERHMEDTHPDHQDILKAIVAFKTLMGQCQD
LRKRKQLELQILSEPIQAWEGEDIKNLGSVIFMSQVMVQYGACEEKEERYLMLFSNVLIM
LSASPRMSGFIYQGKIPIAGTVVTRLDEIEGNDCTFEITGNMVERIVVHCNNNQDFQEWL
EQLNRLIRGPASCSSLSKTSSSSCSAHSTFSQSFSSTGQPRGPLEPPQIIKPWSLSCLRP
APPLRPSAALGYKERMSYILKESSKSPKTMKKFLHKRKTERKPSEEEYVIRKSTAALEED
AQILKVIEAYCTSANFQQGHGSSTRKDSIPQVLLPEEEKLIIEETRSNGQTIMEEKSLVD
TVYALKDEVKELKQENKRMKQCLEEELKSRRDLEKLVRRLLKQTDECIRAESSSKTSILP
NT seq 2343 nt   +upstreamnt  +downstreamnt
atgaatccagaagaacaaatcgtgacatggcttatatctttgggagttttagattcccct
aaaaagaccatctgtgatccggaggagtttttaaagtcctcgctgaaaaatggggtagtt
ctgtgcaaactgatcaacagactcatgcctggctctgtggaaaagttttgtctagatccc
caaactgaagctgactgcatcaacaacatcaatgactttctgaaaggatgtgcaaccctc
caagtggaagtatttgatcctgatgacctttattcaggggtcaatttctccaaggttctg
agtactctcttagctgtcaacaaagcaacagaagatcagctatcagaaagaccatgtgga
cgttcctcttctcttagtactgctaataattctcagacaaacccacagggagcagtttct
agcacagtttcagggctgcaaaggcagtcaaagacagtggagatgacggaaaatggaagt
catcagttaatagtaaaagcaagattcaactttaagcagactaatgaggatgaactgtca
gtttgtaagggggacatcatttacgtcactcgagttgaagaaggaggctggtgggaaggc
acattaaatgggagaacaggctggttccccagtaattacgtccgtgaaattaaatccagt
gagagacctctctcccccaaggccatcaaaggatttgaaactgctccacttaccaagaat
tattatactgtggtgttacagaacatcctggacactgaaaaagaatatgctaaagaactt
cagtctcttcttgttacttacttaagacccctgcagtccaataacaatctgagtactgtg
gaggttatgtctttactgggaaacttcgaggaagtatgcacatttcaacagacactctgc
caagccttggaagaatgttcaaagtttccagaaaaccagcaaaaagtaggaggttgtcta
ctgagtctcatgcctcattttaaatctatgtatctggcttactgtgcaaaccatccttca
gctgtaaatgtactcactcagcacagtgatgagttggaacaattcatggaaaatcaaggt
gcatcgagcccaggtatcctcattttaacaacaagcctcagcaaaccattcatgcgactg
gagaaatatgttactctcttgcaagagttggaacggcatatggaggatactcatccagat
caccaggatattctgaaagcaatcgtagcattcaaaactctcatggggcaatgtcaagat
ctgaggaagagaaaacagctggagttacagatactgtcggaacctattcaggcatgggaa
ggagaagatattaaaaacttgggaagtgtgatttttatgtcacaagtaatggtgcagtat
ggagcatgtgaggaaaaagaggagcggtaccttatgttattttcaaatgtcctgataatg
ttatctgcaagtcctcggatgagtggctttatctatcagggaaaaataccaatagcagga
acggtggtgactagattagatgaaattgaagggaatgactgcacatttgaaatcactggt
aacatggtggagagaattgtggtccattgcaacaataaccaggacttccaggaatggttg
gagcagctgaacagactgatcagaggacctgcctcttgcagttcattatccaaaacctca
tcgtcatcatgcagtgctcattccacattttcccagtcttttagctctactggacagccc
cgaggacccttggagcctcctcaaattataaaaccgtggagtttaagttgtctacgacct
gcacctccacttagaccatcagcagcactaggttataaagagaggatgtcttatatctta
aaggagtctagtaaaagccctaaaacgatgaagaaatttcttcataaaaggaagactgaa
agaaaaccatcagaggaggaatatgtgattaggaaaagtacagctgctctggaagaggat
gctcagatccttaaagtgatcgaagcctactgcaccagtgcaaactttcaacaaggccat
ggctcaagtactcgaaaagattccattccccaagtcctacttcctgaggaagagaaactc
atcattgaagaaaccagaagcaacggccagaccatcatggaagaaaagagccttgtcgat
actgtttacgccttgaaggacgaggtcaaagaactgaagcaggaaaataaaagaatgaag
caatgcctggaagaagaattgaagtcaagaagggacctagaaaagctggtgcggaggctt
ttgaagcaaacagatgagtgtattcgagccgagtccagtagcaagacctcaattcttcca
taa

DBGET integrated database retrieval system