KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682452
Entry
104682452         CDS       T03989                                 

Gene name
FHL1
Definition
(RefSeq) four and a half LIM domains protein 1 isoform X1
  KO
K14365  four and a half LIM domains protein 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104682452 (FHL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rro04990]
    104682452 (FHL1)
Domain-containing proteins not elsewhere classified [BR:rro04990]
 LIM domain-containing proteins
  FHL family proteins
   104682452 (FHL1)
SSDB
Motif
Pfam: LIM Ureidogly_lyase
Other DBs
NCBI-GeneID: 104682452
NCBI-ProteinID: XP_010387414
UniProt: A0A2K6QGM6
LinkDB
Position
7
AA seq 339 aa
MASHRHSGPSSYKVGTMAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECR
KPIGADSKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPKCKGC
FKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVK
CNKAITSGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGC
KNPITGKRTVSRVSHPVSKARKPPVCHGKRLPLTLFPSANLRGRHPGGERTCPSWVVVLY
RKNRSLAAPRGPGLVKAPVWWPMKDNPGTTTASTAKNAP
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcttcccatagacactcaggtccctccagctataaggtgggcaccatggcggagaag
tttgactgccactactgcagggaccccttgcaggggaagaagtatgtgcaaaaggatggc
caccactgctgcctgaaatgctttgacaagttctgtgccaacacctgtgtggaatgccgc
aagcccatcggtgcggactccaaggaggtgcactataagaaccgcttctggcacgacacc
tgcttccgctgtgccaagtgccttcaccccttggccaatgagacctttgtggccaaggac
aacaagatcctgtgcaacaagtgcaccactcgggaggactcccccaagtgcaaggggtgc
ttcaaggccattgtggcaggagatcaaaacgtggagtacaaggggaccgtctggcacaaa
gactgcttcacctgtagtaactgcaagcaagtcatcgggactggaagcttcttccctaaa
ggggaggacttctactgcgtgacttgccatgagaccaagtttgccaagcattgcgtgaag
tgcaacaaggccatcacatctggaggaatcacttaccaggatcagccctggcatgccgat
tgctttgtgtgtgttacctgctctaagaagctggctgggcagcgtttcaccgctgtggag
gaccagtattactgcgtggattgctacaagaactttgtggccaagaagtgtgctggatgc
aagaaccccatcactgggaaaaggactgtgtcaagagtgagccacccagtctctaaagct
aggaagcccccagtgtgccacgggaaacgcttgcctctcaccctgtttcccagcgccaac
ctccggggcaggcatccgggtggagagaggacttgtccctcgtgggtggtggttctttat
agaaaaaatcgaagcttagcagctcctcgaggcccgggtttggtaaaggctccagtgtgg
tggcctatgaaggacaatcctggcacgactactgcttccactgcaaaaaatgctccgtga

DBGET integrated database retrieval system