KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682633Help
Entry
104682633         CDS       T03989                                 

Gene name
MET
Definition
(RefSeq) hepatocyte growth factor receptor
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04360  Axon guidance
rro04510  Focal adhesion
rro04520  Adherens junction
rro05100  Bacterial invasion of epithelial cells
rro05144  Malaria
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05211  Renal cell carcinoma
rro05218  Melanoma
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    104682633 (MET)
   04015 Rap1 signaling pathway
    104682633 (MET)
   04010 MAPK signaling pathway
    104682633 (MET)
   04151 PI3K-Akt signaling pathway
    104682633 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104682633 (MET)
   04520 Adherens junction
    104682633 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    104682633 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104682633 (MET)
   05202 Transcriptional misregulation in cancer
    104682633 (MET)
   05206 MicroRNAs in cancer
    104682633 (MET)
   05205 Proteoglycans in cancer
    104682633 (MET)
   05230 Central carbon metabolism in cancer
    104682633 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104682633 (MET)
   05226 Gastric cancer
    104682633 (MET)
   05218 Melanoma
    104682633 (MET)
   05211 Renal cell carcinoma
    104682633 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    104682633 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    104682633 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104682633 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104682633 (MET)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104682633 (MET)
Protein kinases [BR:rro01001]
 Receptor tyrosine kinases (RTK)
  MET family
   104682633 (MET)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Sema TIG Pkinase PSI Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 104682633
NCBI-ProteinID: XP_030788937
LinkDB All DBs
Position
6
AA seq 1400 aa AA seqDB search
MKSKSKCLAECLAHDKPLTMKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKY
QLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDC
SSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCI
FSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPHHPLHSISVRRLKE
TKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLSVQRETLNAQTFHTRIIRF
CSINSGLHSYMEMPLECILTEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDI
LFGVFAQSKPDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRT
LLRNSSGCEARRDEYRAEFTTALQRVDLFMGQFSEVLLTSISTFVKGDLTIANLGTSEGR
FMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHPLNQNGYTLVVTGKKITKIPLNGLGCR
HFQSCSQCLSAPPFVQCGWCHDKCVRSEDCPSGTWTQQICLPAIYKVFPTSAPLEGGTRL
TICGWDFGFRRNNKFDLKKTRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIIS
NGHGTTQYSTFSYVDPIITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKS
VSNSILECYTPAQTISTEFAVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTIT
GVGKNLHSVSVPRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFF
MLDGILSKYFDLIYVHNPVFKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKS
CENIHLHSEAVLCTVPNDLLKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSI
SIALLLLLGLFLWLKKRKQIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESV
DYRATFPEDQFPNSSQNGSCRQVHYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPE
LVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEV
SQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDL
IGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKT
GAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRR
LLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKC
VAPYPSLLSSEDNADDEVDT
NT seq 4203 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtaaatcaaagtgtttagcagaatgcctcgcacatgataaacctctcacaatg
aaggcccccgctgtgcttgcacctggcatcctcgtgctcctgtttaccttggtgcagagg
agcaatggggagtgtaaagaggcactagcaaagtccgagatgaatgtgaatatgaagtat
cagcttcccaacttcaccgcggaaacacccatccagaatgtcattctacatgagcatcac
attttcctcggtgccaccaactacatttatgttttaaatgaggaagaccttcagaaggtt
gctgagtacaagaccgggcctgtgctggaacacccagattgtttcccgtgtcaggactgc
agcagcaaagccaatttatcaggaggcgtttggaaagataacatcaacatggctctagtt
gtcgacacctactatgatgatcaactcattagctgtggcagcgtcaacagagggacctgc
cagcgacatgtctttccccacaatcatactgctgacatacagtcggaggttcactgcata
ttctccccacagatagaagagcccagccagtgccctgactgtgtggtgagcgccctggga
gccaaagtcctttcatctgtaaaggaccggttcatcaacttctttgtaggcaataccata
aattcttcttatttcccgcatcatccgttgcattcgatatcagtgagaaggctaaaggaa
acgaaagatggttttatgtttttgacagaccagtcctacattgatgttttacctgagttc
agagattcttaccccattaagtacgtccatgcctttgaaagcaacaattttatttacttc
ctgtcagtccaaagggaaactctaaatgctcagacttttcacacaagaataatcaggttc
tgttccataaactctggattgcactcctacatggaaatgcctctagagtgtattctcaca
gaaaagagaaaaaagagatccacaaagaaggaagtgtttaatatccttcaggctgcatat
gtcagcaagccgggggcccaacttgctagacaaataggagccagcctgaatgatgacatt
ctctttggggtgttcgcacaaagcaagccagattctgccgaaccaatggatcgatctgca
atgtgtgcattccctatcaaatatgtcaacgacttcttcaacaagatcgtcaacaaaaac
aatgtgagatgtctccagcatttttatggacccaatcatgagcactgttttaataggacg
ctcctgagaaattcatcaggctgtgaagcgcgccgtgatgaatatcgagcagagtttacc
acagctttgcagcgcgttgacttattcatgggtcaattcagtgaagtcctgttaacatct
atatccacctttgtgaaaggagacctcaccatcgctaatcttgggacatcagagggtcgc
ttcatgcaggttgtggtttctcgatcaggaccatcaacccctcatgtgaattttctcctg
gactctcacccggtgtctccagaagtgatcgtggagcatccattaaaccagaatggctac
acactggttgtcacagggaagaagatcaccaagatcccattgaatggcttgggctgcaga
catttccagtcctgcagtcagtgcctctctgccccaccgtttgttcagtgtggctggtgc
cacgacaaatgtgtgcgatcggaggactgccccagtgggacatggactcaacagatctgt
ctgcctgcaatctacaaggttttcccaactagtgcaccccttgaaggagggacaaggctg
accatatgtggctgggactttggatttcggaggaataataaatttgatttaaagaaaact
agagttctccttggaaatgagagctgcaccttgactttaagtgagagcacgatgaataca
ttgaaatgcacagttggtcctgccatgaataaacatttcaatatgtccataattatttca
aatggccacggaacaacacaatacagtacattctcctatgtggatcctataataacaagt
atttcgccaaaatatggccctatggctggtggcactttacttactttaactggaaattac
ctaaacagtgggaattctagacacatttcaattggtggaaaaacatgtactttaaaaagt
gtgtcaaacagtattcttgaatgttataccccagcccaaaccatttcaactgagtttgct
gttaaattgaaaattgacttagccaaccgagagacaagcatcttcagttaccgggaagac
cccattgtctatgaaattcatccaaccaaatcttttattagtggtgggagcacaataaca
ggtgttgggaaaaacctgcattcagttagtgtcccgaggatggtcataaatgtgcatgaa
gcaggaaggaactttacagtggcatgtcagcatcgctctaattcagagataatctgctgt
accactccttccctgcaacagctgaatctgcaactccccctgaaaaccaaagcctttttc
atgttagatgggatcctttccaaatactttgatctcatttatgtacataatcctgtgttt
aagccttttgaaaagccagtgatgatctcaatgggcaatgaaaatgtactggaaattaag
ggaaatgatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaataagagt
tgtgagaatatacacttacattctgaagccgttttatgcacggtccccaatgacctgctg
aaattgaacagcgagctaaatatagagtggaagcaagcaatttcttcaaccgtccttgga
aaagtaatagttcaaccagatcagaatttcacaggattgattgctggtgttgtctcaata
tcaatagcactcttactactacttgggcttttcctgtggctgaaaaagagaaagcaaatt
aaagatctgggcagtgaattagttcgctatgatgcaagagtacacactcctcatttggat
aggcttgtaagtgcccgaagtgtaagcccaactacagaaatggtttcaaatgaatctgta
gactaccgagctacttttccagaagatcagtttcctaactcatctcagaacggttcatgc
cgacaagtgcactatcctctaacagacatgtcccccatcctgactagtggagactctgat
atatccagtccattactgcaaaacactgtccacattgacctcagcgctctaaatccagag
ctggtccaggcagtgcagcatgtagtgattgggcccagtagcctgattgtgcatttcaat
gaagtcataggaagagggcattttggttgtgtatatcatgggactttgttggacaatgat
ggcaagaaaattcactgtgctgtgaaatccttgaacagaatcactgacataggagaagtt
tcccaatttctgaccgagggaatcatcatgaaagattttagtcatcccaatgtcctctcg
ctcctgggaatctgcctgcgaagtgaagggtctccactggtggtcctaccatacatgaaa
catggagatcttcgaaatttcattcgaaatgagactcataatccaactgtaaaagatctt
attggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaaaaagtttgtc
cacagagacttggctgcaagaaactgtatgctggatgaaaaattcacagtcaaggttgct
gattttggtcttgccagagacatgtatgataaagaatactatagtgtgcacaacaaaaca
ggtgcaaagctgccagtgaagtggatggctttggaaagtctgcaaactcaaaagtttacc
accaagtcagatgtgtggtcctttggcgtactactctgggagctcatgacaagaggagcc
ccaccctatcctgacgtgaacacctttgatataactgtttacttgttgcaagggagaagg
ctcctacaacccgaatactgcccagaccccttatatgaagtaatgctaaaatgctggcac
cctaaagccgaaatgcgcccatccttttctgaactggtgtcccggatatcagcgatcttc
tctactttcattggggagcactatgtccatgtaaacgctacttatgtgaacgtaaaatgt
gtcgctccatatccttctctgttgtcatcagaagataacgctgatgacgaggtggacaca
tga

DBGET integrated database retrieval system