KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682880
Entry
104682880         CDS       T03989                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01522  Endocrine resistance
rro01524  Platinum drug resistance
rro04012  ErbB signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04110  Cell cycle
rro04115  p53 signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04218  Cellular senescence
rro04630  JAK-STAT signaling pathway
rro04921  Oxytocin signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05203  Viral carcinogenesis
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05216  Thyroid cancer
rro05217  Basal cell carcinoma
rro05218  Melanoma
rro05219  Bladder cancer
rro05220  Chronic myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104682880 (CDKN1A)
   04630 JAK-STAT signaling pathway
    104682880 (CDKN1A)
   04066 HIF-1 signaling pathway
    104682880 (CDKN1A)
   04068 FoxO signaling pathway
    104682880 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    104682880 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104682880 (CDKN1A)
   04115 p53 signaling pathway
    104682880 (CDKN1A)
   04218 Cellular senescence
    104682880 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104682880 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    104682880 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104682880 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    104682880 (CDKN1A)
   05206 MicroRNAs in cancer
    104682880 (CDKN1A)
   05205 Proteoglycans in cancer
    104682880 (CDKN1A)
   05203 Viral carcinogenesis
    104682880 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104682880 (CDKN1A)
   05212 Pancreatic cancer
    104682880 (CDKN1A)
   05225 Hepatocellular carcinoma
    104682880 (CDKN1A)
   05226 Gastric cancer
    104682880 (CDKN1A)
   05214 Glioma
    104682880 (CDKN1A)
   05216 Thyroid cancer
    104682880 (CDKN1A)
   05220 Chronic myeloid leukemia
    104682880 (CDKN1A)
   05217 Basal cell carcinoma
    104682880 (CDKN1A)
   05218 Melanoma
    104682880 (CDKN1A)
   05211 Renal cell carcinoma
    104682880 (CDKN1A)
   05219 Bladder cancer
    104682880 (CDKN1A)
   05215 Prostate cancer
    104682880 (CDKN1A)
   05213 Endometrial cancer
    104682880 (CDKN1A)
   05224 Breast cancer
    104682880 (CDKN1A)
   05222 Small cell lung cancer
    104682880 (CDKN1A)
   05223 Non-small cell lung cancer
    104682880 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104682880 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104682880 (CDKN1A)
   05161 Hepatitis B
    104682880 (CDKN1A)
   05160 Hepatitis C
    104682880 (CDKN1A)
   05163 Human cytomegalovirus infection
    104682880 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104682880 (CDKN1A)
   05169 Epstein-Barr virus infection
    104682880 (CDKN1A)
   05165 Human papillomavirus infection
    104682880 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    104682880 (CDKN1A)
   01522 Endocrine resistance
    104682880 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 104682880
NCBI-ProteinID: XP_010387996
UniProt: A0A2K6QEX5
LinkDB
Position
4
AA seq 164 aa
MSEQAGNVRPNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
PRSGEQPEESPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcagaacaggctgggaatgtccgtccgaacccatgcggcagcaaggcctgccgccgc
ctcttcggcccagtggacagcgagcagctgagccgtgactgtgatgcgctaatggcgggc
tgtatccaggaggcccgtgagcgatggaacttcgactttgtcaccgagacaccactggag
ggtgacttcgcctgggagcgtgtgcggggccttggcctgcccaagctctaccttcccaca
gggccccggcggggccgggatgagttgggaggaggcaggcggcctggcacctcgcctgct
ctgctgcaggggacagcagaggaagaccatgtggacctgtcgctatcttgtacccttgtg
cctcgctcaggggagcagcctgaagagtccccaggtggacctggagactctcagggtcga
aaacggcggcagaccagcatgacagatttctaccactccaaacgccggctgatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system