KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682907
Entry
104682907         CDS       T03989                                 

Gene name
KCNK5
Definition
(RefSeq) potassium channel subfamily K member 5
  KO
K04916  potassium channel subfamily K member 5
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
rro04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    104682907 (KCNK5)
  09157 Sensory system
   04742 Taste transduction
    104682907 (KCNK5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104682907 (KCNK5)
Ion channels [BR:rro04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   104682907 (KCNK5)
SSDB
Motif
Pfam: Ion_trans_2 Ion_trans
Other DBs
NCBI-GeneID: 104682907
NCBI-ProteinID: XP_010388028
UniProt: A0A2K6NI31
LinkDB
Position
4
AA seq 505 aa
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKI
LEVVSDAAGQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGL
FGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPF
VFMVTEGWNYIEGLYYSFITISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSL
FVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSRKALQVKGSAASKDVNIFSFLSKKEET
YNDLIKQIGKKAMKTSGGGETGPGPGPGPGPGLGPQGGGLPALPPSLVPLVVYSKNRVPT
LEEVSQTLRSKGHVSRPPDEEAVARTPEDSSPAPEVFMNQLDRISEECEPWDAQDYHPLI
FQDASITFVNAEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSDESTFTS
TESELSVPYEQLMNEYNKANSPKGT
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggtggaccggggccctctgcttacctcggccatcatcttctacctggccatcggggcg
gcgatcttcgaagtgctggaggagccacactggaaggaggccaagaaaaactactacaca
cagaagctgcatctgctcaaggagttcccgtgcctgggtcaggagggcctggacaagatc
ctagaggtggtatctgatgctgcaggacagggcgtggccatcacagggaaccagaccttc
aacaactggaactggcccaatgcaatgatttttgcagcgactgtcatcaccaccattgga
tatggcaatgtggctcccaagacccctgctggtcgcctcttctgcgtcttctatggtctc
ttcggggtgccgctctgcctgacgtggatcagtgccctgggcaagttcttcgggggacgc
gccaagagactagggcagttccttaccaagagaggcgtgagtctgcggaaggcgcagatc
acgtgcacagtcatcttcatcgtgtggggcgtcctggtccacctggtgatcccacccttc
gtgttcatggtgactgaggggtggaactacatcgagggcctctactactccttcatcacc
atctccaccatcggcttcggtgactttgtggctggtgtgaaccccagcgccaactaccac
gccctgtaccgctacttcgtggagctctggatctacttggggctggcctggctgtccctt
tttgtcaactggaaggtgagcatgtttgtggaagtccataaagccattaagaagcggcgg
cgacgacggaaggagtcctttgagagctccccacactcccggaaggccttgcaggtgaag
ggaagcgcagcctccaaggacgtcaacatcttcagctttctttccaagaaggaagagacc
tacaacgacctcatcaagcagatcgggaagaaggctatgaagacaagcgggggtggggag
acgggcccgggcccgggcccgggcccgggcccagggctggggcctcaaggcggtgggctc
ccagcactgcccccttccctggtgcccctggtggtctactccaagaaccgggtgcccacc
ttggaagaggtgtcacagacactgaggagcaaaggccacgtatcaaggcccccagatgag
gaggccgtggcacggacccctgaagacagctcccctgcccccgaggtgttcatgaaccag
ctggaccgcatcagcgaggaatgcgagccatgggacgcccaggactaccacccactcatc
ttccaggacgccagcatcaccttcgtgaacgcggaggctggcctctcggacgaggagacc
tccaagtcctcgctagaggacaacttggcaggggaggagagcccccagcagggggccgaa
gccaaggcacccctgaacatgggcgagttcccctcctccgacgagtccaccttcaccagc
actgagtctgagctctccgtgccttacgaacagctaatgaatgagtacaacaaggctaac
agccccaagggcacgtga

DBGET integrated database retrieval system