KEGG   Roseiflexus sp. RS-1: RoseRS_0829Help
Entry
RoseRS_0829       CDS       T00542                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:rrs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RoseRS_0829
Enzymes [BR:rrs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     RoseRS_0829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC YCII
Motif
Other DBs
NCBI-ProteinID: ABQ89243
UniProt: A5URJ0
LinkDB All DBs
Position
complement(1030174..1031685)
Genome map
AA seq 503 aa AA seqDB search
MATPPVYQNLIGGKFVDSASGRTFENRNPADTRDIIGIFQDSDERDVQAAVEAAKRAYRH
WRLVPAPKRGEILFKAAQLLVERKEQYARDMTREMGKVLKETRGDVQEAIDMCFFMAGEG
RRLYGQTTPSEMPNKFQMSVRQPLGVCGLITPWNFPMAIPSWKILPALIVGNTVVIKPAS
DTPLSVYNLVQCLLDAGIPDGVVNIVTGSGSRVGEPLIRHPDVQVISFTGSTEIGSKVAR
VGAEGMKHVSLEMGGKNPMIVMDDANLDLVVDGAIWGAFGTTGQRCTATSRLIAHRAIVG
ELTERLADRAERLKIGNGLDETVEMGPAINRSQLETVQRYVEIGKSEGARLIVGGQALRD
GDYAYGFFHQPTIFADVQRTMRIAQEEIFGPVLSIITVDSLEEAIDVANDVPYGLSSAIY
TRDVNAAFRAMRDLYTGIVYVNAPTIGAEIHLPFGGTKGTGNGHREGGIQVLDVFSEWKS
IYIDFSGTLQRAQIDTYQVGMEG
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggctacccctccagtgtaccagaatctgatcggcgggaaatttgtcgactcggcgagt
gggcgcacattcgagaatcgcaacccggctgacacccgtgacatcatcgggatttttcag
gatagcgacgaacgtgacgtccaggcggcggttgaggcggcgaagcgggcataccgtcac
tggcggctggttcctgcaccaaaacgcggcgagattctcttcaaagcggcgcagttgctc
gtcgagcgcaaagagcagtatgcgcgcgatatgacccgtgagatgggcaaagtgctcaaa
gaaacgcgcggcgatgtgcaggaagccatcgacatgtgcttcttcatggcgggtgaaggg
cgccgcctctacggacaaacgaccccgtccgaaatgcccaacaagttccagatgtcggtg
cgccagccgcttggcgtctgcggactgatcacgccgtggaacttcccgatggcgatccct
tcgtggaagattctgccagcgctgatcgttgggaacacggtcgttatcaagcccgcctcc
gacacgccgctctcagtgtacaacctggtgcagtgcctgctcgacgccggcatccccgat
ggcgtggtcaacatcgtcaccggcagcggcagtcgggtcggcgagccactcatccgccat
cccgatgtccaggtcatctcgttcaccggttcaacggaaattggcagcaaggttgcgcgg
gtcggcgccgagggaatgaagcacgtctcactggagatgggcggcaaaaacccgatgatc
gtgatggacgacgccaacctggatctggtggtggatggcgcgatctggggcgcattcggc
acgacggggcagcggtgcactgccacgtcacggttgatcgcccatcgcgcgatcgtcggt
gaactgaccgagcgcctggcagatcgcgctgaacggctgaagatcggcaatggtcttgat
gaaaccgttgagatgggaccggcgatcaaccggagtcaactcgagacggtgcagcgatac
gtcgagattgggaagagcgagggggcgcgactaatcgtcggcgggcaggcgctgcgcgat
ggcgattatgcctatgggttctttcaccagccaacgatctttgccgatgtgcagcgcacc
atgcgcattgcccaggaagagattttcggtccggtgctgtcgatcatcactgtcgatagc
ctggaagaggcgatcgacgtcgccaacgacgtgccctacggtctatcatcggcgatctac
acccgcgacgtcaacgctgctttccgtgccatgcgcgatctctacaccggcattgtgtat
gtgaatgcgccgacgattggcgcggagatccatctgccgttcggcggcacaaagggtacc
ggcaacggtcaccgcgaaggcggcattcaggtgctcgacgttttcagcgagtggaaatcg
atctacatcgatttttcgggaacgcttcagcgggcgcagatcgacacctaccaggtggga
atggagggatga

DBGET integrated database retrieval system