KEGG   Roseiflexus sp. RS-1: RoseRS_1726Help
Entry
RoseRS_1726       CDS       T00542                                 

Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00010  Glycolysis / Gluconeogenesis
rrs00020  Citrate cycle (TCA cycle)
rrs00620  Pyruvate metabolism
rrs01100  Metabolic pathways
rrs01110  Biosynthesis of secondary metabolites
rrs01120  Microbial metabolism in diverse environments
rrs01130  Biosynthesis of antibiotics
rrs01200  Carbon metabolism
Module
rrs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rrs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RoseRS_1726
   00020 Citrate cycle (TCA cycle)
    RoseRS_1726
   00620 Pyruvate metabolism
    RoseRS_1726
Enzymes [BR:rrs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RoseRS_1726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABQ90116
UniProt: A5UU13
LinkDB All DBs
Position
complement(2121625..2123004)
Genome map
AA seq 459 aa AA seqDB search
MPDITMPKMGFDMQEGTIVRWLKKPGDAVRRGEPIAEIETDKVTIEIEAFESGTLTEIVV
QEGQSAPVNAVIARLDGGNGSQAPVPVAAAPAVPPPAEVSPPPAPLPETPAPLAEPPADI
GDIRASPLARRLAREYGIDLRQVRGSGPAGRIVKEDIEAYLSARGGAPAPTPVSAPPPAP
AAVSAPPPAPAAVSAPPPAPAAVSAPPPAPAAVSAPPPAPAAVSVAQPTAGAVVPLSNMR
KTISRRMIQSWQQFPHIFVSIEVDMGAALALRAQANAGRPREDQISVNDMVVKACAVALL
AFPNLNASYSDDGIILHPTVNIAIAVALESGLMAPVVANCQDRSLGSIARETKRIVALAR
EGKITPDLLQGGTFTVSNLGMYGIPEFTSIITPPQAASLAVGAIRRTPAFKDDSDEVVAK
HLMMLTLSADHRVTDGAEVARFLNDVKRLLEQPLALLVG
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacattactatgcccaagatgggcttcgatatgcaggagggcacgatcgttcgc
tggctgaaaaagccgggtgacgcggtgcgccgcggcgaaccgattgccgaaatcgagacc
gataaggtgacgatcgaaatcgaggcgttcgagtctggcactctgacggagattgtcgtt
caggaagggcagtctgcgccggtcaatgcggtcatcgcccggctcgacggcgggaatggt
tcgcaggcgcctgtaccggtcgccgctgcgccagcagttcccccgcctgcggaggtgtcg
cctccgcctgcgccgcttcccgaaacaccggcgcctctggcagagcctccggcggacatt
ggtgacatccgcgcatccccgctggcgcgtcggctggcgcgtgagtacggcatcgacctt
cgccaggtgcgcggcagtggtccggcagggcgaatcgtaaaggaagatattgaggcgtac
ctgagcgctcgcggcggtgcacccgcccccacgccggtcagtgcgcccccgcccgctccc
gcagcggtcagcgcacccccgcccgctcccgcagcggtcagcgcacccccgcccgctccc
gcagcggtcagcgcacccccgcccgctcccgcagcggtcagcgcacccccgcccgctccc
gcagcggtcagtgtggcgcaacccacagcgggcgccgttgtaccgttgagcaatatgcgc
aaaacgatttcgcgccggatgatccagagctggcagcagttcccccatattttcgtctcg
atcgaggttgatatgggcgcggcgctcgctctgcgcgcccaggcgaatgccggacgcccc
agagaggatcagatctcggtcaacgatatggtggtcaaggcatgcgctgtcgcgctcctg
gcattcccgaacctgaacgcttcctacagcgatgatgggatcatcctgcacccgactgtg
aacatcgccatcgcggtggcgctggagagcggactgatggcgccggtcgtcgccaactgc
caggatcggtcgctcggatcaatcgcgcgtgaaaccaaacgaatcgttgcgctggcgcgc
gaggggaagatcacccccgacctgctccaggggggcacatttacggtcagcaatctggga
atgtacggcattcccgaattcacctcgatcatcaccccgccacaggcggcgagtctggca
gtcggcgccattcgccgcaccccggcgttcaaggacgacagcgacgaagttgtggcaaag
cacctgatgatgctgaccctctcggcggatcaccgggtcaccgatggcgccgaagttgcc
cggtttctcaacgacgtcaaacgactgctcgaacagccgctggcgctactggtcggttag

DBGET integrated database retrieval system