KEGG   Roseiflexus sp. RS-1: RoseRS_2734Help
Entry
RoseRS_2734       CDS       T00542                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00010  Glycolysis / Gluconeogenesis
rrs00030  Pentose phosphate pathway
rrs00051  Fructose and mannose metabolism
rrs00052  Galactose metabolism
rrs00680  Methane metabolism
rrs01100  Metabolic pathways
rrs01110  Biosynthesis of secondary metabolites
rrs01120  Microbial metabolism in diverse environments
rrs01130  Biosynthesis of antibiotics
rrs01200  Carbon metabolism
rrs01230  Biosynthesis of amino acids
rrs03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rrs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RoseRS_2734
   00030 Pentose phosphate pathway
    RoseRS_2734
   00051 Fructose and mannose metabolism
    RoseRS_2734
   00052 Galactose metabolism
    RoseRS_2734
  09102 Energy metabolism
   00680 Methane metabolism
    RoseRS_2734
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    RoseRS_2734
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rrs01009]
    RoseRS_2734
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rrs03019]
    RoseRS_2734
Enzymes [BR:rrs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RoseRS_2734
Protein phosphatases and associated proteins [BR:rrs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RoseRS_2734
Messenger RNA biogenesis [BR:rrs03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     RoseRS_2734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DUF190
Motif
Other DBs
NCBI-ProteinID: ABQ91106
UniProt: A5UWV3
LinkDB All DBs
Position
3399778..3402003
Genome map
AA seq 741 aa AA seqDB search
MVRSTGIGVLTSGGDAPGMNAALRAVVRTALSRSVPVYAIYEGYRGMVEGGDRIRPLGWD
DVGGIMHRGGTIIGTARCREFRTREGRLQAAANLIAHGINRLVVIGGDGSLTGADTFRRE
WSSLLAELVETGKLSRDTAAQYPFLALVGLVGSIDNDFYGTDMTIGADSALHRITAAIDA
LVSTAASHQRTFVVEVMGRHCGYLALMGAIAGGADYVLIPENPPEPGWEDRMCTLLRAGR
ASGRRESIVVIAEGARDRDGNPISADYVRRVLEERMGEDARVTILGHVQRGGTPSAFDRW
MSTLVGYAAVEELLSATPEREPQLIGMRYHRITRQPLMHCVEQTRQVATAINAGDYQRAM
ELRSGSFKEMFQTFQALSSALPSVTRARKSRIALLHAGGPAPGMNTAIRAAVRLGLDQGH
TMLVVRNGFDGLIAGEISECEWQTVDGWGAMGGAELGTSRRVPAGEDLAAVAQALTRHRI
DGLLVIGGWNGYQAAHRLYQERAAYESFNIPIICLPASINNDLPGSELSIGADTALNAIV
ESLDRIKQSAVAVRRTFVVEVMGRYCGYLALMSGLASGAERVYLHEEGITLDDLRTDIQM
MIEGFRHGKRLSLIIRNEYANRLYTTDVICALFEEEGKDLFDVRRAVLGHLQQGGSPSPY
DRIQATRLAARCIRFLSEELDRGTAAAAFIGFVNGKVRVFDLGELPHMVDAAFRRPKDQW
WLELAPIARALAQQKYDTREA
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggtgcggtcaacaggcatcggtgtgctgaccagcggtggcgatgcgccgggcatgaat
gccgctttacgtgcggttgtgcgtaccgcgctgagccgcagcgtgccggtgtacgccatt
tatgaaggataccgcggtatggtggaaggcggcgaccgtattcgcccgcttggttgggat
gatgtcggcggcattatgcatcgtggcggaacgatcattggcacggcgcgctgccgcgag
ttccgtacccgcgagggacggttgcaggctgctgcgaacctgatcgcacacgggatcaat
cgcctggtggtcatcggcggcgatggcagcctgaccggcgccgatacgtttcgtcgcgaa
tggtccagtctgctggcggaactggtggaaaccggcaaactatcacgcgacaccgccgcg
cagtaccccttcctggcgctggttggactggtcggatcgatcgacaacgatttttacggc
accgacatgacgatcggcgccgattcggcgctgcaccgcattactgctgccatcgatgcg
ctcgtcagcacggctgccagccatcagcgcacctttgtcgtcgaggttatgggacggcac
tgcgggtatctggcactgatgggggcaattgccggtggcgccgattatgtgctcatcccc
gaaaatccacctgaaccgggctgggaagatcgcatgtgcacgctgctgcgcgccgggcgc
gcgtccggtcgacgcgaaagtatcgttgtcatcgctgagggcgcgcgtgatcgtgatggc
aatccgatctcagccgactatgtccggcgggtgctggaggagcgcatgggtgaagatgcg
cgcgtcacaatcctgggacacgtgcagcgcggcggaacaccgagcgccttcgaccgctgg
atgagcacgctggtcgggtatgcggctgtcgaagaattgttgagcgccacacccgaacgt
gagccgcagttgatcggtatgcgctaccatcgtatcacccgtcaaccgctgatgcactgc
gtggagcagacgcgacaggtggcgacggcgatcaatgctggcgactatcagcgtgcgatg
gaactgcgcagcggcagtttcaaagagatgttccagactttccaggcgctcagcagcgcc
ctgccaagcgtcacccgtgcgcgcaaaagccggatagcgctgctgcatgccggcggaccc
gcccccggtatgaacaccgccatccgcgcggcagtgcgccttggtctcgatcaggggcat
accatgctggtggtgcgcaacggcttcgacggtcttatcgccggagagatcagtgagtgc
gagtggcagacggttgatggttggggggcgatgggcggcgccgagctgggaaccagccga
cgggtgcctgccggtgaggacctggcggcagttgcgcaggcgctaaccaggcatcgcatc
gacggcttgctcgtcattggcgggtggaacggttaccaggcggcgcatcgtctctatcag
gaacgcgccgcgtatgaatcgttcaacatcccgattatatgtctgcctgcctcgatcaat
aatgacctgccaggatcggagttgagcattggcgccgatacggcattgaatgcaatcgtc
gaatcgctcgaccgcattaagcaatcggcggtggcagtgcgacgcacctttgtggttgag
gtgatgggacgctactgcggctatctggcgttgatgagcgggctggcatcgggtgcggaa
cgggtctatctgcacgaagagggtataacgctcgacgatctgcgcaccgacattcagatg
atgatcgagggatttcgccacgggaaacgtctcagcctgatcattcgcaacgagtatgcg
aaccgtctctatacgaccgacgtcatctgtgctctgttcgaggaagaaggaaaggacctg
ttcgatgtgcgccgcgccgtgctgggtcatttgcagcagggaggcagtccgtcaccctac
gaccgcatccaggcgacacgcctggcggcacgctgcattcgcttcctgagcgaggaactc
gaccgcggcacggcggctgcggcgtttatcggctttgtcaacggcaaggtgcgcgtgttc
gacctgggcgaattgccgcatatggtcgatgccgccttccgtcgtccaaaagatcaatgg
tggctggaactggcgccgattgcacgggcgctcgcacaacaaaagtacgatacgagggaa
gcatga

DBGET integrated database retrieval system