KEGG   Roseiflexus sp. RS-1: RoseRS_2753Help
Entry
RoseRS_2753       CDS       T00542                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00620  Pyruvate metabolism
rrs00680  Methane metabolism
rrs00720  Carbon fixation pathways in prokaryotes
rrs01100  Metabolic pathways
rrs01120  Microbial metabolism in diverse environments
rrs01200  Carbon metabolism
Module
rrs_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rrs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RoseRS_2753
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    RoseRS_2753
   00680 Methane metabolism
    RoseRS_2753
Enzymes [BR:rrs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     RoseRS_2753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Toprim_3 HD_4
Motif
Other DBs
NCBI-ProteinID: ABQ91125
UniProt: A5UWX2
LinkDB All DBs
Position
3430436..3433294
Genome map
AA seq 952 aa AA seqDB search
MSHVTRRENERLSATIRFLGNLLGEVIRNQAGEEAFRLVEQLRTLGKELRNGEPDRADAS
LRALASQMTVTDVQTVIKAFNAYFLLVNLAEQMQRVWILRDREQASPTAPRTESIAAAIA
EIHAHNVSAVTVQEWLETARIQPVFTAHPTEARRRTALEKVRRLATLLDRRSGGLQGFEL
EENTLRIREEIVSLWQTDEVRVVKPTVIDEVKNGLFYFESGLFDLIPRLYRELEYALRTA
YPDHEWRVPPLLRYGAWMGGDRDGNPNVTHAVTLQTVRLLRAAAVQRHITTIEELSHRLG
QSTRQAPVSEELRASLANDAALFPDVADMLTQRNPYELYRQKCTYIREKLLRTLNDANTA
SLDWGRSDPPPNGAYLRSDDLLADLRVMEQSLRANNAAVVADGALRDLIRQVEVFGLHTA
TLDIRQHSERHTAALAEVLASAGVCADYTALNETERIDLLSREIGNPRPLIPAHLDYSPD
TVEVIQTFRTIAAILNRLSPEAIETYIVSMTRGASDLLAPLLLAKEAGLFRPFRFSRLNI
APLFETGADLTCCDTILEACLSLPVYRDHLALRGNLQEVMIGYSDSNKDVGYVAANWALY
QAQRKLRDFGRRYGIHMRLFHGRGGAIGRGGGPANHAILAQPPGSIGNQIKITEQGEVIA
DRYGLPLLAHRHIEQVMNAVLRAGLLQRDDPPAEWMQALERLADLSQRHYRALVYERNDF
VPYFHNVTPITEISRLNIGSRPASRRNTGRIEDLRAIPWVFSWMQSRHTLPGWYGMGFAL
ETFVYKGDGIDLDMSGDSGNVTGDGTTDHVGSAIDRLALLQEMYARWSFFRVMIDNAQMI
LGKADLHIAARYAELAPDREAAASIFAAIRDEYGRTDRMIRQIARIERLLDNSPVLQHSI
QRRNPYIDPMSYLQIELLRRLRAAPDGPQHAAIEDAILLSISGLAAGLMNTG
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacgtgacccgtcgtgaaaacgagcgtctttcagcaacgatccgttttctggga
aacctgctcggcgaagtcattcgcaaccaggcaggcgaagaggcgtttcgattggtcgaa
cagttgcggacgctggggaaagaactgcgcaacggcgaacctgatcgcgccgacgcatct
ctccgcgcactggcgtcgcagatgaccgtcaccgatgttcagacagtcatcaaggcgttc
aacgcctactttctcctcgtgaaccttgccgaacagatgcagcgcgtctggattctgcgc
gaccgcgagcaagcaagcccgacggcgccacgcaccgagtcgattgctgccgcaattgcg
gagatccacgcccacaacgtgtccgcagtcacggtgcaggagtggctcgaaaccgcgcgt
attcagccggtattcaccgcccacccgaccgaggcgcgccgccgcaccgcactggaaaag
gttcgtcgcctggcaaccctgctcgaccggcgatcaggcggtttacaagggtttgaactt
gaagagaacacgctgcgcattcgtgaagagatcgtctcattgtggcagaccgatgaggtg
cgggtcgtgaagccaaccgtgatcgacgaagtcaagaacggcctgttctactttgaaagc
ggactgttcgatctcatcccgcgcctctaccgcgaactggagtatgcgttacgcacagcg
tacccggatcacgagtggcgtgtgccgcctctgttgcgctacggagcgtggatgggcggc
gaccgtgacggcaatccgaacgtcacccacgccgtgacccttcagacggttcgcctgctg
cgcgccgccgccgtgcagcgccacataaccaccatcgaagaactcagccatcgtcttggt
caatcgacgcgacaggcgcctgtcagcgaggaactgcgcgcatcgctggcgaacgatgcc
gccctcttccccgatgtcgccgatatgctcacgcaacgcaatccctacgaactctaccgt
cagaaatgcacctacatccgcgaaaaactgctgcgcaccctcaatgacgccaataccgct
tcgctcgattggggacgatcagatccgccgccgaacggcgcatatctcagaagcgacgat
ctgctcgccgatctgcgggtgatggaacagagtctgcgcgccaataatgccgcagtggtc
gccgatggcgcactgcgcgacctcatccgccaggttgaagtcttcggtctgcacacagcc
accctcgatattcgccagcatagtgagcggcataccgctgcgctcgccgaggtgctggca
tccgcaggcgtatgcgccgactacacagcactcaacgagactgaacggatcgatctcctg
tcacgcgagatcggaaacccgcgtccactcattcccgctcatctcgactactcacccgac
acggtcgaagtcattcaaacattccgcaccatcgcagcgatcctcaaccgcctcagcccg
gaagccatcgagacgtacatcgtgagcatgacgcgcggtgcgagcgatctgctggcgcca
ctcctgctggcaaaagaggcgggattgttccgccccttccgtttcagccgattgaacatc
gcgccactcttcgagaccggcgccgacctcacgtgttgcgacacgatacttgaagcatgt
ctgagtttgccggtctaccgcgatcatctggcgctgcgcggcaacctgcaagaagtgatg
atcggctactccgacagcaacaaggacgtaggctatgtcgccgccaactgggcgctttac
caggcgcagcgcaaactgcgtgattttgggcgacggtacggcatccacatgcgcctgttc
cacgggcgtggcggcgccattgggcgcggcggcggaccggcgaaccacgccatcctggcg
caaccgcccggcagcattggcaaccagatcaaaatcaccgagcagggcgaagtcatcgcc
gaccggtacggattgcccctgctggcgcaccgtcatatcgaacaggtgatgaatgccgtt
ctgcgcgctggtctgctgcagcgtgacgaccctccggcggagtggatgcaggcgctcgaa
cgtctggcagacctgtcgcagcgccactatcgcgcgcttgtgtatgaacggaacgatttc
gttccatacttccacaacgttaccccgatcaccgaaatcagccgcctcaacattggcagt
cgcccggcaagccgccgcaataccgggcgcatcgaagacctgcgcgccattccgtgggta
ttcagctggatgcagagtcgccacacccttccgggctggtacggtatggggtttgcactc
gaaacgttcgtgtacaaaggggatggcatcgatctggacatgagcggcgacagcgggaac
gtgaccggcgacggaacgaccgaccacgtggggtcagccatcgaccgtctcgcgctgctg
caggagatgtacgccaggtggtcttttttccgggtcatgatcgacaatgcccagatgatt
ctgggcaaagccgacctccatattgctgcacgttacgccgaacttgcgccggatcgagaa
gcggcggcgtccattttcgccgccatccgcgacgagtatggacgcaccgaccggatgatc
cgccagatcgcccggatcgaacgcctgctcgacaatagcccggtgctgcaacactcgatc
cagcgtcgcaacccgtatatcgatccgatgagttacctgcagatcgaactgttgcgccgg
ttgcgtgccgcacccgacggaccgcagcatgccgccatcgaggatgccatcctgctcagc
atcagcgggctggcggcagggctgatgaataccgggtaa

DBGET integrated database retrieval system