KEGG   Rhodococcus rhodochrous: 4535765_00409Help
Entry
4535765_00409     CDS       T05521                                 

Gene name
fadJ
Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rrt  Rhodococcus rhodochrous
Pathway
rrt00071  Fatty acid degradation
rrt00280  Valine, leucine and isoleucine degradation
rrt00281  Geraniol degradation
rrt00310  Lysine degradation
rrt00362  Benzoate degradation
rrt00380  Tryptophan metabolism
rrt00410  beta-Alanine metabolism
rrt00640  Propanoate metabolism
rrt00650  Butanoate metabolism
rrt00903  Limonene and pinene degradation
rrt00930  Caprolactam degradation
rrt01100  Metabolic pathways
rrt01110  Biosynthesis of secondary metabolites
rrt01120  Microbial metabolism in diverse environments
rrt01130  Biosynthesis of antibiotics
rrt01200  Carbon metabolism
rrt01212  Fatty acid metabolism
Module
rrt_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rrt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4535765_00409 (fadJ)
   00650 Butanoate metabolism
    4535765_00409 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4535765_00409 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4535765_00409 (fadJ)
   00310 Lysine degradation
    4535765_00409 (fadJ)
   00380 Tryptophan metabolism
    4535765_00409 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4535765_00409 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    4535765_00409 (fadJ)
   00281 Geraniol degradation
    4535765_00409 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    4535765_00409 (fadJ)
   00930 Caprolactam degradation
    4535765_00409 (fadJ)
Enzymes [BR:rrt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     4535765_00409 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     4535765_00409 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     4535765_00409 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored AlaDh_PNT_C adh_short_C2 2-Hacid_dh_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: SNV10362
LinkDB All DBs
Position
1:444324..446459
Genome map
AA seq 711 aa AA seqDB search
MISWEKDADGIVVLTLDDPNQGANTMNELYKASMKATVDRLYEEQDSITGVVITSAKKTF
FAGGDLRNIIEIGPEDAQAAFDEVQGIKADLRRLETLGKPVVAAINGAALGGGLEIALAT
HHRIAADVKGVQIGLPEASLGLLPGGGGITRTVRLLGIQTALLSVLLQGNKYNAVKAKEI
GLIHDVVGSVEELVPAAKEWIKANPEGGVQPWDVKGYKIPGGTPASPALAANLPAFPANL
RKQIKGAPMPAPRAIMAAAVEGSQVDFDNASTIESRYFVELATGQVAKNMIQAFFFDMQS
INSGASRPKDVPKREIKKVGVLGAGMMGAGIAYVSAKAGFDVVLKDVTLEAAERGKNYSE
KIEAKALSRGKTTEEKSKALLDRIKPTADAADFAGVDFVIEAVFENTELKHKVFQEIEDI
VDPDALLGSNTSTLPITGLATGVKRPEDFIGIHFFSPVDKMPLVEIIKGEKTSDEALARV
FDYTLAIRKTPIVVNDSRGFFTSRVIGTFVNEAIAMLGEGIEPATIEQAGSQAGYPAPPL
QLTDELNMKLMQKIAKETEEAAKQGDTKLGASRHPALDVVDWMIEQGRPGRLEKAGFYEY
DENGKRQGIWQGVRDHYKTEATLDVPLQDLIDRMLFAEAIETQKCFDEGVLETTADANIG
SIFGIGFPAWTGGVAQYIVGYPGGKEGFVKRAEELAAKYGERFNPPASLRS
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgatttcctgggagaaggacgccgacggcatcgttgtgctgaccctcgacgaccccaac
cagggcgccaacacgatgaacgagctgtacaaggcgtcgatgaaggccaccgtcgaccgc
ctgtacgaggagcaggactccatcaccggtgtggtgatcacctccgcgaagaagaccttc
ttcgccggcggcgacctgcgcaacatcatcgagatcggccccgaggacgcgcaggccgcg
ttcgacgaggtccagggcatcaaggccgacctgcgtcgcctcgagaccctcggtaagccc
gtcgtcgccgctatcaacggcgcggctctcggtggcggtctcgagatcgccctcgcgacg
caccaccgcatcgccgccgacgtcaagggtgtccagatcggcctgcccgaggccagcctc
ggcctgctccccggtggcggtggcatcacccgcaccgtgcgcctgctcggcatccagacc
gctctgctctcggttctgctgcagggcaacaagtacaacgccgtcaaggccaaggagatc
ggcctgatccacgacgtcgtgggcagcgtcgaggagctcgtcccggccgcgaaggaatgg
atcaaggccaaccccgagggcggcgtccagccgtgggatgtcaagggttacaagatcccc
ggtggcaccccggccagcccggcgctcgccgcgaacctcccggccttccccgcgaacctg
cgcaagcagatcaagggtgccccgatgccggctccgcgcgccatcatggccgctgccgtc
gagggctcgcaggtcgacttcgacaacgcctcgaccatcgagtcgcggtacttcgtcgag
ctcgccaccggccaggtcgcgaagaacatgatccaggcgttcttcttcgacatgcagtcc
atcaactcgggcgcctcgcgtccgaaggacgtgccgaagcgtgagatcaagaaggtcggc
gttctcggcgccggcatgatgggcgcaggcatcgcgtacgtctccgccaaggccggtttc
gacgtcgtcctcaaggacgtcaccctcgaggccgccgagcgtggcaagaactattcggag
aagatcgaggccaaggccctctcgcgtggcaagaccaccgaggagaagtcgaaggctctg
ctcgaccgcatcaagccgacggccgacgccgccgacttcgcgggtgtcgacttcgtcatc
gaggccgtcttcgagaacaccgagctcaagcacaaggtgttccaggagatcgaggacatc
gtcgatcccgacgcgctgctcggttcgaacacctcgacgctgcccatcaccggtctcgcg
accggcgtcaagcgtcccgaggacttcatcggtatccacttcttctcgccggtcgacaag
atgccgctggtcgagatcatcaagggtgagaagacctccgacgaggccctggcccgcgtg
ttcgactacacgctcgcgatccgcaagaccccgatcgtcgtcaacgacagccgcggcttc
ttcacctcgcgcgtgatcggcacgttcgtcaacgaggccatcgccatgctcggcgaaggc
atcgagcccgcgaccatcgagcaggccggttcgcaggcgggctacccggctccgccgctg
cagctgaccgacgagctgaacatgaagctcatgcagaagatcgcgaaggagaccgaggag
gccgccaagcagggcgacaccaagctcggcgcctcgcgacaccccgcactcgacgtcgtc
gactggatgatcgagcagggccgtccgggccgcctcgagaaggccggcttctacgagtac
gacgagaacggcaagcgtcagggcatctggcagggcgtgcgcgatcactacaagaccgag
gcgacgctcgatgtgccgctgcaggatctgatcgaccgcatgctcttcgccgaggcgatc
gagacccagaagtgcttcgacgagggtgttctcgagaccaccgccgacgccaacatcggc
tcgatcttcggcatcggcttcccggcctggaccggtggtgtcgctcagtacatcgtcggc
tacccgggtggcaaggaaggcttcgtcaagcgcgccgaggaactcgccgccaagtacggc
gagcgcttcaacccgccggcgtcgctgcgcagctga

DBGET integrated database retrieval system