KEGG   Rhodococcus rhodochrous: 4535765_00587Help
Entry
4535765_00587     CDS       T05521                                 

Gene name
gabT2
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rrt  Rhodococcus rhodochrous
Pathway
rrt00250  Alanine, aspartate and glutamate metabolism
rrt00410  beta-Alanine metabolism
rrt00640  Propanoate metabolism
rrt00650  Butanoate metabolism
rrt01100  Metabolic pathways
rrt01120  Microbial metabolism in diverse environments
Module
rrt_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rrt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4535765_00587 (gabT2)
   00650 Butanoate metabolism
    4535765_00587 (gabT2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4535765_00587 (gabT2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4535765_00587 (gabT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rrt01007]
    4535765_00587 (gabT2)
Enzymes [BR:rrt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     4535765_00587 (gabT2)
Amino acid related enzymes [BR:rrt01007]
 Aminotransferase (transaminase)
  Class III
   4535765_00587 (gabT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: SNV11367
LinkDB All DBs
Position
1:630092..631333
Genome map
AA seq 413 aa AA seqDB search
MTRLSPRLLQATPVTVDHAEGCYIHGTDGRRYLDFTAGIGVTSTGHCHPHVVEAARRQIG
SLIHGQYTTVMHRPLLELTERLGTVLPEGLDSLFFANSGSEAVEAALRLARQATGRPGIV
VFHGGFHGRTVAAATMTTSGTRFSAGFSPLMGGVHVAPFPTAYRYGWSEDEATDFALQEL
DYLFATLVAPDEIAAFVVEPVLGEGGYVPGNTRFFQGLRQRADEHGILLVFDEIQTGFGR
TGKFFGHQHFDVRPDIITIAKGLASGFPLSGIAASEELMERARPGSQGGTYGANAVSCAA
AVATLDVIEKEGLVDNAAARGRELLSGARENTIDAIGDVRGLGLMVGLEFTTDGAPDRER
ATAAQQLAAQKGLLLLTCGAHMNVVRMIPPLIVTTQQIEDALGIWSEVRAEVR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtctttcaccccgcctgctgcaggcaacgcccgtcaccgtcgaccacgccgaa
gggtgttacatccacggcaccgacggacgtcggtatctcgacttcaccgccggcatcggc
gtcacgagtaccggccactgtcacccgcacgtcgtcgaggccgctcgccgacagatcggc
tcgctcatccacgggcagtacacgaccgtgatgcaccggcccctgctcgaactcaccgaa
cgcctgggcacggtgctccccgaagggctcgactcgctgttcttcgccaattcgggcagc
gaggcagtcgaggcggcgttgcgtctggcccgccaggcgacagggcggcccggaatcgtc
gtcttccacggcggtttccacgggcggaccgtcgccgcagccacgatgaccacctcggga
acccgcttctccgcggggttctcgcccctcatgggcggtgtgcacgtcgcgccgttcccc
actgcctatcgctacggctggtcggaggacgaagcgaccgatttcgccctgcaggaactg
gactacctgttcgcgaccctcgtggcgccggacgagatcgcggccttcgtcgtcgaaccg
gtcctgggcgagggcggttacgtccccggcaacacccggttcttccagggattgcggcag
cgggccgacgaacacggcatcctgctcgtcttcgacgagatccagaccggattcgggcgg
accggaaagttcttcggacatcagcacttcgacgtgcgacccgacatcatcaccatcgcc
aagggcctcgcgagcggtttcccgctgtcgggtatcgccgcctccgaggaactcatggag
cgcgcccgcccgggatcgcagggcggcacgtacggagcgaatgcggtctcctgcgcggcg
gccgtggccactctcgacgtgatcgagaaggaggggctcgtcgacaacgccgccgcacgt
ggacgtgaactgctctccggtgcacgggagaacacgatcgacgccatcggcgacgtgcgc
ggcctcggcctcatggtgggcctcgaattcaccaccgacggagcacccgaccgggagcgg
gcgaccgcagcgcagcagctcgccgcgcagaaggggttgctgctgttgacctgcggtgcg
cacatgaacgtggtgcgcatgatcccgccgctgatcgtcaccacccagcagatcgaggac
gcgctcgggatctggtccgaggtccgcgccgaggtccgataa

DBGET integrated database retrieval system