KEGG   Rhodococcus rhodochrous: 4535765_01237Help
Entry
4535765_01237     CDS       T05521                                 

Gene name
gutB
Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
rrt  Rhodococcus rhodochrous
Pathway
rrt00040  Pentose and glucuronate interconversions
rrt00051  Fructose and mannose metabolism
rrt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4535765_01237 (gutB)
   00051 Fructose and mannose metabolism
    4535765_01237 (gutB)
Enzymes [BR:rrt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     4535765_01237 (gutB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Pyr_redox_2 TrkA_N Pyr_redox Methyltransf_16
Motif
Other DBs
NCBI-ProteinID: SNV14982
LinkDB All DBs
Position
1:1319471..1320490
Genome map
AA seq 339 aa AA seqDB search
MRAAVLLEPGRIEMQERPLPAPEPGDVLVRVTTVGVCGSDAHYYREGRIGEFVVTDPIVL
GHEASGVVVAVGDGVPQSRIGERVSIEPQRPDPLTEETRRGDYNLCPHMRFYATPPVDGA
LCEYVTIGAAFAHPVPDTVSDDAAALCEPLSVGIAAVRKARVTAGSRVLVTGAGPVGIVV
AQVARAFGAVEVVVTDLDERRRETAQSFGASAALDPRVDDPSALRVDAYIDASGAPAAVD
SGIRAVRPGGTVVLVGSGAETMTLPVQLVQNRELILTGVFRYANTWPTALALLGAGRVDL
DSMVTARFPLDKTADALESDRTPGNIKAVVDVTDPAGKD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccgccgtgcttctcgaaccgggccgcatcgagatgcaggaacggccactacct
gcaccggagcccggcgacgtcctcgtccgggtgaccaccgtgggggtgtgcggttcggac
gcgcactactaccgcgaaggacgtatcggcgagttcgtcgtgaccgatccgatcgtgctc
ggccacgaggcgtccggggtcgtggtcgcggtcggagacggtgttccgcagagccggatc
ggcgagcgggtctcgatcgaaccgcaacgccccgacccgctcaccgaggagacgcgccgc
ggcgactacaacctgtgcccgcacatgcgcttctacgccacaccgcccgtcgacggcgcg
ctgtgcgagtacgtcaccatcggggcggccttcgcgcatcccgttccggacacggtgtcc
gacgacgccgccgccctgtgcgagccgctgtcggtcggtatcgcggccgtccggaaggcc
cgtgtcaccgccggctcacgagtcctcgtcaccggcgccgggcccgtcggcatcgtcgtc
gcacaggtcgcgcgcgccttcggtgcggtcgaggtcgtcgtcaccgacctcgacgagcga
cgacgcgagaccgcacagtcgttcggggcgagcgctgcgctcgatccccgcgtcgacgac
ccgtcggccctgcgcgtggacgcctacatcgacgcgtccggcgcccccgccgccgtcgac
tcgggtatccgcgcggtccgtcccggcggcaccgtcgtcctcgtcggatccggcgccgag
acgatgaccctgccggtgcagctggtccagaaccgcgaactgatcctgaccggcgtgttc
cgttacgcgaacacgtggccgaccgcgctcgcgctcctcggggcgggccgggtcgatctc
gactcgatggtcaccgcccggttccccctcgacaagaccgccgacgcactcgaatccgat
cgcacacccggaaacatcaaggccgtcgtggacgtgaccgatccggcgggaaaggactga

DBGET integrated database retrieval system