KEGG   Rhodococcus rhodochrous: 4535765_01969Help
Entry
4535765_01969     CDS       T05521                                 

Gene name
infB
Definition
(GenBank) translation initiation factor 2 infb
  KO
K02519  translation initiation factor IF-2
Organism
rrt  Rhodococcus rhodochrous
Brite
KEGG Orthology (KO) [BR:rrt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rrt03012]
    4535765_01969 (infB)
   03029 Mitochondrial biogenesis [BR:rrt03029]
    4535765_01969 (infB)
Translation factors [BR:rrt03012]
 Eukaryotic type
  Initiation factors
   MTIFs
    4535765_01969 (infB)
 Prokaryotic type
   4535765_01969 (infB)
Mitochondrial biogenesis [BR:rrt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    4535765_01969 (infB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU IF-2 IF2_N GTP_EFTU_D2 Ras MMR_HSR1 SRPRB Roc MMR_HSR1_Xtn Arf
Motif
Other DBs
NCBI-ProteinID: SNV17775
LinkDB All DBs
Position
1:2125927..2128803
Genome map
AA seq 958 aa AA seqDB search
MAGKARVHELAKELGVTSKELLARLKEQGEFVKSASSTVEPPVARRLRESFGKTEGDAAA
KAASTPAPKPGAPRPGPRPTPASPAPAAETARPKPGAPKPAAPKPAPAPEKPAAPAPQAP
AAQAAPQSPAAQAPGATPQAPAAKPGPKPAGPRPGPKTPRVGNNPYSSAPAERPAPRPGA
PRPGPGGPRPAPGQGGPRPTPGQGRPAAGPGGPRPGPGQAGPRPAPGQGGPRPAPGQGGP
RPSPGSMPPRPNPGAMPQRAARPAASGRPGRPGGAPGGRPGGGGGGYRGGGAGGGAPAGA
GAPGGFRGRPGGGGGRGRGGAAGAFGRPGGAPRRGRKSKRQKRQEYDSMQAPSVGGVRLP
RGNGETIRLARGASLSDFAEKIDANPSALVQALFNLGEMVTATQSVNDDILELLGSEMNY
VVQVVSPEDEDRELLESFDIQYGEDEGTEEDLQQRPPVVTVMGHVDHGKTRLLDTIRKAN
VGEGEAGGITQHIGAYQVMTHLNGEDRLITFIDTPGHEAFTAMRARGAKSTDIAILVVAA
DDGVMPQTVEAINHAQAADVPIVVAVNKIDKEGANPQKIRQQLTEYGLVAEEYGGDTMFV
DISAKQNLNIEQLLEAVLLTADAALDLRANPDMEAQGVAIEAHLDRGRGPVATVLVQRGT
LRVGDSIVAGDAYGRVRRMVDEHGEDVLEALPSRPVQVVGFTSVPGAGDNLVVVDEDRIA
RQIADRRNARKRNALAAKSRKRISLEDLDAALKEHNELNLILKGDNSGTVEALEEALMGI
EIDDEVRLRVIDRGVGGVTETNVNLAAASNAVIIGFNVRAEGKATELANREGVDIRYYSV
IYQAIDEVEKALKGMLKPIYEEVELGRAEIRAIFKSSKIGNIAGCLVQSGIVKRNAKARL
LRDNNVVAETVTISSLRREKDDVTEVREGFECGMTITYSDIKVGDVIEAYELREKPRD
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
gtggcaggcaaggcccgcgtgcacgagttggcgaaagaactcggtgtcaccagcaaggaa
ctactcgcacgcctgaaggaacagggcgagttcgtcaagtccgcgtcgtcgacggtcgaa
ccgccggtcgcgcgtcgactccgcgaatcgttcggtaagaccgaaggcgatgcagccgcg
aaggctgcatccacccccgcaccgaagcccggtgccccccggccgggtccccggcccacc
cctgcgagcccggcccccgcggccgagaccgcacgtccgaagcccggcgcaccgaagccg
gccgctcccaagccggctccggcaccggagaagcccgcggctcccgcgccgcaggccccc
gctgcccaggcggcaccgcagtccccggctgctcaggctcccggcgcgacgccgcaggcc
cccgcagcgaagcccggccccaagccggccggtccgcgtccgggtccgaagaccccgcgc
gtcggtaacaacccctactcctcggctccggccgagcgtcccgctccgcgtccgggtgcc
ccgcgccccggcccgggcggaccgcgtccggctcccggacagggcggtccccgccccacg
cccggacagggacgtcccgcagcaggccccggtggcccgcgtcccggacccggccaggcc
ggtccgcgtccggctcccggacagggcggtccccgccccgctcccggtcagggcggaccc
cgtccgtccccgggttcgatgcccccgcgtcccaacccgggtgcgatgccgcagcgtgct
gcgcgtccggccgcgtccggtcgtccgggtcgtccgggcggagctcccggtggtcgtccc
ggtggtggcggcggcggttaccgcggtggcggtgccggtggcggcgcacctgcaggtgca
ggcgctcccggtggtttccgcggtcgccccggtggtggcggtggacgcggtcgcggcggc
gcagccggcgcgttcggtcgtcccggtggcgctccgcgtcgtggtcgcaagtcgaagcgg
cagaagcgccaggaatacgattcgatgcaggcgccgtcggtcggcggcgtgcggttgccg
cgtggcaacggcgagaccatccgtctcgctcgtggcgcatcgctgtccgacttcgccgag
aagatcgacgcgaacccgtcggccctggtgcaggcgctgttcaaccttggtgagatggtc
acggccactcagtcggtgaacgacgacatcctcgagctgctcggctcggagatgaactac
gtcgtgcaggtcgtctcgcccgaggacgaggaccgcgagctgctcgagtcgttcgacatc
cagtacggcgaggacgagggcacggaggaagacctccagcagcgcccgccggtcgtcacc
gtcatgggtcacgtcgaccacggcaagacccgcttgctcgacacgatccgtaaggcgaac
gtcggtgagggcgaggccggtggcatcacccagcacatcggtgcctaccaggtcatgacg
cacctcaacggtgaagatcgcctgatcaccttcatcgacaccccgggtcacgaggcgttc
accgccatgcgtgcccgcggtgcgaagtcgacggacatcgcgatcctcgtggtcgccgcc
gacgacggtgtcatgccgcagacggtggaggcgatcaaccacgcgcaggccgccgatgtc
cccatcgtggtcgcggtgaacaagatcgacaaggagggtgcgaaccctcagaagatccgt
cagcagctcaccgagtacgggctggtcgcggaggagtacggcggcgacaccatgttcgtc
gacatctccgcgaagcagaacctcaacatcgagcagctgctcgaagcggtgctgctcacc
gccgacgcagcgctcgatctgcgggccaacccggacatggaggcgcagggcgtcgccatc
gaggcgcacctcgaccgcggtcgtggtccggtggccacggtgctcgtccagcgcggcacg
ctgcgggtcggcgattccatcgtcgccggcgacgcctacggtcgtgtccgtcgcatggtc
gacgagcacggcgaggatgtcctcgaggcgctcccgtcccggcccgtgcaggtcgtcggc
ttcacgtcggtgcccggcgccggcgacaacctggtcgtcgtcgacgaggaccggatcgct
cggcagatcgccgaccgacgcaacgcccgcaagcgcaacgcgctggcagcgaagagtcgc
aagcggatcagcctggaagatctcgatgccgctctcaaggagcacaacgagctcaacctc
atcctcaagggcgacaactccggtaccgtcgaggccctcgaagaggccctcatgggtatc
gagatcgacgacgaggttcggctgcgggtcatcgaccgcggtgtcggtggcgtcaccgag
accaacgtcaacctggcagcggcttcgaacgctgtgatcatcggcttcaacgttcgcgcc
gaaggcaaggcgacggagctggcgaaccgcgagggtgtcgacatccgctactactcggtc
atctaccaggcgatcgacgaggtggagaaggctctcaagggcatgctcaagccgatctac
gaggaggtcgagctcggccgcgccgagatccgcgcgatcttcaagtcgtcgaagatcggc
aacatcgcgggttgcctcgtgcagtccggcatcgtcaagcgcaacgcgaaggcccgtctg
ctccgcgacaacaacgttgtcgccgagacggtcaccatctcgtcgctgcgacgcgagaag
gacgacgtcaccgaggtccgcgagggcttcgagtgcggtatgacgatcacctactccgac
atcaaggtcggcgacgtgatcgaggcgtacgagttgcgcgagaagccgcgcgactga

DBGET integrated database retrieval system