KEGG   Rhodococcus rhodochrous: 4535765_02469Help
Entry
4535765_02469     CDS       T05521                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rrt  Rhodococcus rhodochrous
Pathway
rrt03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rrt00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    4535765_02469
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rrt03400]
    4535765_02469
Enzymes [BR:rrt01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     4535765_02469
DNA repair and recombination proteins [BR:rrt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     4535765_02469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: SNV19548
LinkDB All DBs
Position
1:complement(2661711..2662649)
Genome map
AA seq 312 aa AA seqDB search
MLATLGPPPTGNWAFEMKWDGQRTLATVTDGQCRLTSRTGNDITRSFPELPHPLTTATDG
RDCIVDGEIVTLDAEGRPSFARLQRRMHVHRPTEELRAELPVLIYLFDVLALDGQSTTEL
SYLERRAVLDDLVVPGPRVQLSPYWTDVDAPTMLTVAREHGLEGIVAKDPDAPYLPGTRS
DGWIKTPLRRNTEVVVVGWLPGSGKAAGGIGSLLLGAHDDEERLVFIGRVGTGFTAATRR
ELRSQLRPLERPTTPLAVAPPARETHGAHWVEPILVGEVEYREYAGGSLRHPSWRGLRTD
KTVPEVDLPGRH
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgaccctcggtccgccgccgaccgggaactgggcgttcgagatgaaatgggac
ggccagcgcaccctcgccacggtgaccgacggacagtgccggctgaccagccgcaccggc
aacgacatcacccggagcttccccgaactcccccacccgctcaccactgcgacggacggc
cgggactgcatcgtcgacggcgagatcgtcacgctcgacgccgaggggcggccgtccttc
gcccggttgcagcgccgcatgcacgtccaccgccccaccgaggagctacgtgccgagcta
ccggtcctgatctacctgttcgacgtcctcgctctcgacggacagtccacgacggagttg
tcctatctggagcgccgggccgtcctcgacgatctggtcgtccccggaccgcgggttcag
ctgtcgccctactggaccgatgtcgacgcaccgaccatgctcacggtcgcgcgcgaacac
ggcctcgaagggatcgtcgccaaggacccggacgcaccgtatctacccgggacccgcagc
gacggctggatcaagacgccgctgcgtcggaacaccgaggtggtcgtcgtcgggtggctc
cccggatccggcaaggctgccggcggcatcggttcactgctgctcggcgcccacgacgac
gaggaacggttggtgttcatcggccgggtcgggacggggttcaccgctgcgaccagacgt
gagttgcgatcgcagctgcgtcccttggagcgaccgacgaccccgttggcagttgcgccg
ccggctcgggagacccacggagcccactgggtggaacccatcctcgtcggagaggtcgag
taccgggagtacgcaggcggaagcctccggcatccgagctggcgaggactacgcaccgac
aagacggtgccggaggtcgatctgcccggccgccactga

DBGET integrated database retrieval system