KEGG   Rhodococcus rhodochrous: 4535765_03432Help
Entry
4535765_03432     CDS       T05521                                 

Gene name
icd_2
Definition
(GenBank) nADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rrt  Rhodococcus rhodochrous
Pathway
rrt00020  Citrate cycle (TCA cycle)
rrt00480  Glutathione metabolism
rrt01100  Metabolic pathways
rrt01110  Biosynthesis of secondary metabolites
rrt01120  Microbial metabolism in diverse environments
rrt01130  Biosynthesis of antibiotics
rrt01200  Carbon metabolism
rrt01210  2-Oxocarboxylic acid metabolism
rrt01230  Biosynthesis of amino acids
Module
rrt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rrt_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rrt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4535765_03432 (icd_2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4535765_03432 (icd_2)
Enzymes [BR:rrt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     4535765_03432 (icd_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: SNV22535
LinkDB All DBs
Position
1:complement(3683479..3684696)
Genome map
AA seq 405 aa AA seqDB search
MSKIKVEGKVVELDGDEMTRIIWQFIKDKLIHPYLDVDLEYYDLGVENRDATDDQVTVDA
ANAIKKYNVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFRAPIIISNVPRL
VPGWTKPVIVGRHAFGDQYRATDFKVDRPGTVTITFTPEDGSEPIQHEVCRIPEDGGVVM
GMYNYKKSIQDFARASLSYGLQRNYPVYLSTKNTILKAYDGMFKDEFQRIYEEEFKAEFD
AAGLTYEHRLIDDMVASSLKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMTPDG
KTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLEHRGKLDNTPEVIEFAQQLE
DVVIKTVEAGQMTKDLALLVGPEQSWLTTEEFLGALDENLQKARA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagatcaaggttgagggtaaggtcgtcgaactcgacggcgacgagatgacccgc
atcatctggcagttcatcaaagacaagctgatccacccgtacctggacgtggatctcgag
tactacgacctcggcgtggagaaccgcgacgccaccgacgatcaggtgacggtcgacgcg
gcgaacgccatcaagaagtacaacgtcggcgtcaagtgcgccaccatcacccccgacgaa
gcgcgcgtcgaggagttcggtctgaagaagatgtggcggtcgcccaacggcaccatccgt
aacatcctcggcggcaccatcttccgcgcccccatcatcatctcgaacgtgccgcgcctg
gtgccgggctggaccaagcccgtcatcgtcggccgccacgcgttcggcgaccagtaccgc
gccaccgacttcaaggtcgaccgcccgggcaccgtcaccatcaccttcacgcccgaggac
ggcagcgagccgatccagcacgaggtctgccggatccccgaggacggcggcgtcgtgatg
ggtatgtacaactacaagaagtccatccaggacttcgcgcgcgcctcgctctcgtacggc
ctgcagcgcaactacccggtctacctgtcgaccaagaacacgatcctgaaggcctacgac
ggcatgttcaaggacgagttccagcggatctacgaggaagagttcaaggcggagttcgac
gccgccggtctcacctacgagcaccgcctcatcgacgacatggtcgcatcgtccctcaag
tgggagggcggctacgtctgggcctgcaagaactacgacggcgacgtccagtccgacacc
gtcgcgcagggctacggctcgctgggcctgatgacctccgtcctgatgaccccggacggc
aagaccgtcgaggcggaggccgcacacggcaccgtcacccggcactaccgtcagcaccag
cagggcaagccgacgtcgaccaacccgatcgcgtcgatcttcgcctggacccgtggcctc
gagcaccgcggcaagctcgacaacacccccgaggtcatcgagttcgcgcagcagctcgag
gacgtcgtcatcaagaccgtcgaagccggtcagatgaccaaggacctcgcactgctcgtc
ggccccgagcagagctggctgaccaccgaggagttcctcggcgcactcgacgagaatctg
cagaaggctcgcgcctga

DBGET integrated database retrieval system