KEGG   Rhodococcus rhodochrous: 4535765_04216Help
Entry
4535765_04216     CDS       T05521                                 

Definition
(GenBank) betaine-aldehyde dehydrogenase
Organism
rrt  Rhodococcus rhodochrous
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: SNV25571
LinkDB All DBs
Position
1:4560968..4562416
Genome map
AA seq 482 aa AA seqDB search
MTDYDKLFIGGEWVAPSTDERLEVFSPATEERVGSVPVAGPKDVDAAVAAARRAFDDGPW
PRTSPAERAQVLAKAISLIEQRNDEIAGVIASELGQPGPSVQMVQMTPALGTLNYYAGLA
DSFNWVEERTGSFGRTRVTREPVGVVAAVIAWNVPLFLCANKIAPALLAGCSVVLKPAPE
APLAVNLIAEIFTEAGLPEGVLSVVPGGAETGENLVSHPDIDKITFTGSTAVGKHIGEIA
ARNLKRCSLELGGKSAAIVLEDADLDSTIAMLVMSGLINTGQACVGQTRILAPRSRYDEV
VEKVAGATAFFPVGPPGDEAAQIGPLISAKQRDRVEGYIAKGKEEGARVVIGGGRPAHLD
KGYFVEPTIFADVDNSMTIAREEIFGPVLCVLPYDSVDEAVKIANDSDYGLAGSVYTTDI
EKGLEIASRVRTGTYGINWYAFDPGSPFGGFKNSGIGRENGPEGLEAFCELKSVLYPPGY
EG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactacgacaagttgttcatcggcggcgaatgggtggcaccgtcgaccgacgag
agactcgaggtgttctcccccgccaccgaggagcgcgtcggctccgtgccggtcgcggga
ccgaaggacgtcgacgccgcggtcgccgccgcccggcgtgccttcgacgacgggccgtgg
ccgcgcacgtcgccggccgaacgcgcccaggtactcgccaaggccatctcgctcatcgag
cagcgcaacgacgagatcgccggcgtcatcgcctccgaactcggacagccgggcccctcc
gtccagatggtgcagatgaccccggccctgggcacgctgaactactatgccggactggcg
gactcgttcaactgggtcgaggaacggaccgggtccttcggccgcacccgcgtcacccgc
gaaccggtcggcgtcgtcgccgccgtcatcgcgtggaacgtgccgctgttcctgtgcgcc
aacaagatcgcacccgccctgctcgccggatgctcggtggtgctcaagcccgcacccgag
gctccgctggccgtgaacctcatcgccgagatcttcaccgaggcaggtcttcccgaaggc
gtgctgtcggtggttccgggcggcgccgagaccggcgagaacctcgtgtcccatcccgac
atcgacaagatcaccttcaccggttcgaccgcggtgggcaagcacatcggcgagatcgca
gcacgcaacctcaagcgctgctcactcgaactcggcggcaagtccgcggccatcgtcctc
gaggacgccgacctcgactccaccatcgccatgctcgtgatgtcggggctcatcaacacc
ggtcaggcatgtgtcggccagacacgcatcctggctccgcgctcccgctacgacgaggtc
gtcgagaaggtcgccggcgcaaccgcattcttccccgtcggccctcccggcgacgaggcc
gcgcagatcggtccgctgatctccgccaagcagcgcgaccgcgtcgagggctacatcgcc
aagggcaaggaagagggtgcccgcgtcgtgatcggcggcggccgtccggcgcacctcgac
aagggttacttcgtcgagccgacgatcttcgccgacgtcgacaactcgatgacgatcgcc
cgtgaggagatcttcggtcccgtgctgtgcgtgctgccctacgacagcgtcgacgaggcc
gtgaagatcgccaacgactccgactacggcctcgccggttcggtgtacaccaccgacatc
gagaagggcctcgagatcgcgtcgcgtgtgcgcaccggaacgtacggaatcaactggtac
gcattcgatcccggttcgccgttcggcggcttcaagaactcgggcatcgggcgtgagaac
ggccccgaaggactcgaggcgttctgcgaactgaagtccgtgctctacccgcccggctac
gagggctga

DBGET integrated database retrieval system