KEGG   Rhodococcus rhodochrous: 4535765_04311Help
Entry
4535765_04311     CDS       T05521                                 

Gene name
gsiA_5
Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
rrt  Rhodococcus rhodochrous
Pathway
rrt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rrt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    4535765_04311 (gsiA_5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rrt02000]
    4535765_04311 (gsiA_5)
Transporters [BR:rrt02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    4535765_04311 (gsiA_5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_21 AAA_29 Mg_chelatase AAA_22 TniB AAA_16 Sigma54_activat DUF87 AAA_7 AAA_23
Motif
Other DBs
NCBI-ProteinID: SNV25991
LinkDB All DBs
Position
1:complement(4665722..4666735)
Genome map
AA seq 337 aa AA seqDB search
MTTQPILEVRNLRAYIGTPRGTVRAVDDVSLDLDSGQALGIVGESGSGKSVMARAIMGLM
PPRSGRSGSVTFQGRDLLALTKKEKREIWGKQIAMVFQDPGRSLNPVVRVERQLTEGMRK
HLGVSRSEAHTRALKLLEEVGVPDPERRLRNYPHEMSGGMRQRVMIAIALACEPDLLIAD
EPTTALDVTIQRQILDLLRRVQRDRGMSMMLISHDLAVVAGRTDRVSVMYAGRLAEVGST
REVFEQPMHRYTHALLGATPTIDHVRHAPLRVIGGSLPDPTSPPEGCRFAPRCNHASDQC
HTTPPPLESVGVDHHVACLSPVTVPVGAVSGGESHGR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgactactcagccgattctcgaagtgagaaatctccgtgcctacatcggcacgccacga
ggcaccgtccgcgcagtggacgacgtgtcgctcgacctggactccggacaggcgctgggt
atcgtcggcgagtcgggctccggaaagtcggtgatggcccgggcgatcatggggctcatg
ccaccccgctcgggccgatccggatcggtgaccttccagggccgcgacctgctggccctg
accaagaaggagaagcgcgagatctggggcaaacagatcgcgatggtcttccaggatccg
ggtcgttcgctcaatccggtcgtccgggtcgagcgacagctcaccgaggggatgcggaag
cacctcggcgtcagcagatccgaggcacacacgcgggcgctgaagctcctcgaggaggtg
ggcgtccccgatccggaacgacgcctccgcaactatccccacgagatgtccggtggcatg
cgccagcgcgtgatgatcgcgatcgcgctggcgtgcgaaccggatctgctcatcgccgac
gaaccgacgaccgccctggacgtgacgatccagcgtcagatcctcgacctgctgcggcgc
gtccagcgcgaccggggcatgtcgatgatgctcatcagtcacgacctcgcggtggtcgcg
ggtcgcaccgaccgggtgtcggtgatgtacgcggggcggctcgccgaagtcggttccacc
cgtgaggtgttcgagcagccgatgcaccgctacacccacgcactgctcggggcgaccccg
acgatcgaccacgtgcggcacgcaccgctgcgggtgatcggcgggtcgctgcccgacccg
acctcaccgcccgaggggtgccggttcgcgccgcgctgcaatcacgcgtcggaccagtgc
cacaccacgccgcccccactcgagtcggtgggcgtcgatcatcacgttgcgtgtctgagc
ccggtgaccgttccggtcggggccgtttccggaggtgaatcccatggccggtag

DBGET integrated database retrieval system