KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A0620Help
Entry
Rru_A0620         CDS       T00310                                 

Gene name
chlL
Definition
(RefSeq) protochlorophyllide reductase iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00860  Porphyrin and chlorophyll metabolism
rru01100  Metabolic pathways
rru01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rru00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rru_A0620 (chlL)
Enzymes [BR:rru01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Rru_A0620 (chlL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA AAA_24 MeaB AAA_26 MipZ SRP54 DUF87 ABC_tran AAA_10 NB-ARC AAA_25 AAA_16 RNA_helicase
Motif
Other DBs
NCBI-GeneID: 3834356
NCBI-ProteinID: YP_425711
UniProt: Q2RWS1
LinkDB All DBs
Position
complement(734184..735071)
Genome map
AA seq 295 aa AA seqDB search
MFDETMRQPPDGEGSVQVEMDPALHIETAKVFAIYGKGGIGKSTTSSNLSAAFSKLGKRV
VQIGCDPKHDSTFTLTKRLVPTVIDVLQAVHFHTEELRVEDFVYEGYNGVMCVEAGGPPA
GTGCGGYVVGQTVKLLKEHHILEDADVVVFDVLGDVVCGGFATPLQHAERALVVAANDFD
SIFAANRIAAAIQAKAKNYDVRLGGIIANRSVATDQIERFNARSGMRTLAHFPDLDVIRR
SRLCKSTLFEMEPSPELAAVQQEYLRLAEALWEGVEPLTATPLIDREIFDLLGFD
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgacgaaaccatgcgccagccgcccgacggcgaaggcagcgtccaggttgaaatg
gacccggcgctgcacatcgagacggccaaggtcttcgccatctatggcaagggcggtatc
ggcaagtcgaccacctcgtccaatctgtcggcggctttttccaagctgggcaagcgggtg
gtgcagatcggctgcgatcccaagcatgattccaccttcaccctgaccaagcgtctggtg
cccaccgtcatcgacgtcctgcaggccgtgcatttccataccgaggaactccgcgtcgag
gatttcgtctacgagggctacaacggcgtgatgtgcgtggaagccggcggtccaccggcg
ggcaccggctgcggcggctatgtcgtcggccagaccgtcaagctgctcaaggagcatcac
atcctggaagacgccgatgtggtggtcttcgatgtgctgggcgacgtggtctgtggcggc
ttcgccacccccttgcaacatgccgagcgagccctggtggtcgccgccaatgacttcgat
tcgatcttcgcggccaaccgcatcgccgcggcgatccaggccaaggcgaagaattacgac
gtgcgcctgggcggcatcatcgccaatcgcagcgtcgccaccgaccagatcgagcggttc
aatgcccgctcgggtatgcggaccctggcccatttccccgatctcgacgtcatccggcgc
tcccggctctgcaagtcgaccctgttcgagatggagccatcgcccgaactcgccgccgtc
cagcaggaatacctgcgcctggccgaggctctgtgggagggggtcgagcccctgaccgcg
acgccgttgatagaccgggaaatctttgaccttctggggttcgactga

DBGET integrated database retrieval system