KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1417Help
Entry
Rru_A1417         CDS       T00310                                 

Definition
(RefSeq) thioredoxin-disulfide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Brite
KEGG Orthology (KO) [BR:rru00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rru_A1417
Enzymes [BR:rru01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Rru_A1417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored DAO HI0933_like AlaDh_PNT_C K_oxygenase NAD_binding_7 Thi4 FAD_binding_3 Glutaredoxin FMO-like NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 3834832
NCBI-ProteinID: YP_426505
UniProt: Q2RUH7
LinkDB All DBs
Position
complement(1673738..1675318)
Genome map
AA seq 526 aa AA seqDB search
MLDSNLKAQVKTYLENVTQPIELVASLDESAKSEEMLDLLEDIAGLSDKITLIGRDDEGR
KPSFSINRAGTDIGVRFAGLPMGHEFNSLILALLHVGGHPSKTAPEVVEQIESLDGDYNF
ETYFSLSCQNCPDVVQALNLMSALNPRIKHTAIDGALFQDEVESRQVMAVPAIYLNGEPF
AQGRMTLEQILAKLDTGAAERTAAKLKDKEAFDVLVIGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMGIENFISVAHTEGPKLAAALESHVKDYAVDIMNLQRAEKLIPAKTPGG
LVEVQLASGAALKARTVILSTGARWRQMNVPGEDAYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDARLRADQVLQTKLASLNNVTIITSALTSEVHGDG
AKVVGLSYKDRTTEEFHRIDLDGIFVQIGLVPNTEWLKGTVALSPRGEIEIDARGQTSLP
GVFAAGDATTVPYKQIIIAMGEGSKAALSAFDYLIRLPQAEETAAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttggacagcaatctcaaagcccaggtgaagacctatctcgaaaatgtcacccagccg
atcgaactggtcgcctcgctcgacgagagcgcgaagtccgaagagatgcttgacctgctc
gaagacatcgccgggctttccgataagatcaccctgatcggtcgcgacgacgagggccgc
aagccgtcgttctcgatcaaccgcgccggcaccgatatcggcgtgcgcttcgccggcctg
ccgatgggccatgaattcaattcgttgatcctcgccctgctccacgttggcggccatccg
tcgaagacggcgcccgaggtggtcgagcagattgaaagcctggacggcgactataatttc
gaaacctatttctcgctctcgtgccagaactgccccgatgtggtgcaggccctcaatctg
atgagcgcgctcaacccccgcatcaagcacacggccatcgatggcgccttgttccaagac
gaggtcgaaagccgtcaggtcatggccgtgccggccatttacctcaacggcgagcccttc
gcccagggccgtatgacgcttgaacagatcctggccaagcttgacaccggcgcggccgag
cgcacggcggccaagctcaaggacaaggaggccttcgacgttctggtcatcggtggcggt
ccggccggcgccgcggcggcgatctatgccgcgcgcaagggcatccgcaccggggtggcg
gccgaacgcttcggcggtcaggtgctcgataccatgggcatcgagaacttcatttccgtg
gcccataccgaaggccccaagctggccgccgccctggaaagccacgtcaaggactacgcc
gtcgacatcatgaacctccagcgcgccgaaaagctgatcccggccaagacgcccggcggt
ctggtcgaggtgcagttggccagcggcgcggcgctgaaggcccgcaccgtcatcttgtca
accggcgcccgctggcggcagatgaatgtgccgggcgaggatgcctatcgcaacaagggc
gtcgcctattgcccgcattgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaattcgggcgtggaagccgccatcgatctggccggcatcgtcgcccatgtc
accctgatcgaattcgacgcccgcctgcgcgccgatcaggtgttgcagaccaagctcgcc
agcctgaacaacgtgacgatcatcacctcggccctgaccagcgaagtccacggcgatggc
gccaaggtggtcggcctcagctacaaggaccgcaccaccgaggaattccaccgcatcgac
cttgacggcatcttcgtgcagatcggtctggtgcccaatacggaatggctgaagggcacg
gtcgccctcagcccgcgcggcgaaatcgagatcgacgcccgcggccaaacctcgctgccc
ggcgttttcgccgccggcgacgccaccacggtgccctataagcagatcatcatcgccatg
ggcgaaggctccaaggccgcgctgtcggccttcgattacctgatccgcctgccccaggcc
gaagaaaccgccgccgcctga

DBGET integrated database retrieval system