KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1691Help
Entry
Rru_A1691         CDS       T00310                                 

Definition
(RefSeq) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00270  Cysteine and methionine metabolism
rru00330  Arginine and proline metabolism
rru00410  beta-Alanine metabolism
rru00480  Glutathione metabolism
rru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rru00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rru_A1691
   00330 Arginine and proline metabolism
    Rru_A1691
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rru_A1691
   00480 Glutathione metabolism
    Rru_A1691
Enzymes [BR:rru01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     Rru_A1691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 Methyltransf_12 Methyltransf_24
Motif
Other DBs
NCBI-GeneID: 3835111
NCBI-ProteinID: YP_426778
UniProt: Q2RTQ4
LinkDB All DBs
Position
complement(1982256..1983107)
Genome map
AA seq 283 aa AA seqDB search
MTEWFSETLHPHWRQSFAADRVLLREQTAHQDLVILENQTFGRVMVLDGMVQLTERDEFV
YHEMIAHVPLFGHGAARRVLIIGGGDGGTLREVLRHKTVERATMVEIDATVVEMARDHMP
MVSDGAFDDPRAELIIADGIAFVAGAHQPYDVIIIDSTDPFGPAEGLFTPAFYGACRQLL
TPGGVLVVQAGVPFLQPREIAHVNAALSAAFPEVAFYAIAVPTYVGGLMTLGWASEDAGK
KVPDPAVLAARVAASGLAFGYYSPEGHAGAFALPPHIRAAARG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatggttcagcgagacccttcacccccattggcgccagagcttcgccgccgac
cgcgtgctcttgcgcgaacagaccgcccatcaggatctggtgatcctcgagaatcagacc
ttcggccgggtgatggtgcttgacggcatggtgcagctgaccgagcgcgacgaattcgtc
tatcacgagatgatcgcccatgtgccgttgttcggccacggcgcggcgcggcgggtgcta
atcatcggcggcggcgatggcggcacgctgcgcgaagtcctgcgccataaaaccgtcgag
cgggcgaccatggtcgaaatcgacgccaccgtcgtcgagatggcgcgcgaccatatgccg
atggtcagcgatggcgccttcgacgatccgcgcgccgagctgatcatcgccgacggcatc
gccttcgtcgccggcgcccatcagccctatgacgtgatcatcatcgattccaccgatccc
ttcggtccggccgaggggctgttcaccccggccttctatggcgcctgccgccagttgctg
accccgggcggcgtgctggtggtgcaggccggcgtgcccttcctgcagccgcgcgagatc
gcccatgtcaacgccgccctgtcggcggccttccccgaggtggccttctatgccatcgcc
gttcccacctatgtcggcggcttgatgaccctgggctgggcgagcgaggatgccggcaag
aaggttcccgatccggcggttctggccgcgcgggtggcggccagcggccttgcgttcggc
tattactcgcccgagggccatgccggcgccttcgccctgcccccccatatccgcgccgcc
gcccgaggctga

DBGET integrated database retrieval system